BLASTX nr result
ID: Forsythia21_contig00010307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00010307 (353 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012856836.1| PREDICTED: nudix hydrolase 17, mitochondrial... 97 5e-18 ref|XP_011073590.1| PREDICTED: nudix hydrolase 18, mitochondrial... 89 9e-16 ref|XP_012852785.1| PREDICTED: nudix hydrolase 18, mitochondrial... 84 3e-14 ref|XP_011083132.1| PREDICTED: nudix hydrolase 18, mitochondrial... 82 2e-13 >ref|XP_012856836.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Erythranthe guttatus] gi|604302254|gb|EYU21840.1| hypothetical protein MIMGU_mgv1a013711mg [Erythranthe guttata] Length = 212 Score = 96.7 bits (239), Expect = 5e-18 Identities = 51/71 (71%), Positives = 58/71 (81%), Gaps = 1/71 (1%) Frame = -2 Query: 352 MTVNEAKEVCAHWWMKEALDAFVCQFTCMQR-KEEEPLASCRLEYHRSEESRMSIGGAQN 176 M+V EA+EVCAH WMKEALDAFVCQF QR EEEPLASCRLE R++E R+SIGG Q+ Sbjct: 143 MSVEEAREVCAHSWMKEALDAFVCQFNPRQRVVEEEPLASCRLELCRTDELRLSIGG-QS 201 Query: 175 ADEEVDYYLIS 143 ADE+VD YL S Sbjct: 202 ADEDVDCYLFS 212 >ref|XP_011073590.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Sesamum indicum] Length = 210 Score = 89.4 bits (220), Expect = 9e-16 Identities = 46/70 (65%), Positives = 57/70 (81%) Frame = -2 Query: 352 MTVNEAKEVCAHWWMKEALDAFVCQFTCMQRKEEEPLASCRLEYHRSEESRMSIGGAQNA 173 MTVNEA+EVCAH WMKEAL+AFV QFT QR E++PL SCRLE R+EE R+SI G +++ Sbjct: 143 MTVNEAREVCAHSWMKEALEAFVSQFTPQQRVEDDPL-SCRLELCRTEELRLSI-GVESS 200 Query: 172 DEEVDYYLIS 143 DEE D +L+S Sbjct: 201 DEEADCFLVS 210 >ref|XP_012852785.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Erythranthe guttatus] gi|604305366|gb|EYU24510.1| hypothetical protein MIMGU_mgv1a013935mg [Erythranthe guttata] Length = 206 Score = 84.3 bits (207), Expect = 3e-14 Identities = 47/70 (67%), Positives = 53/70 (75%) Frame = -2 Query: 352 MTVNEAKEVCAHWWMKEALDAFVCQFTCMQRKEEEPLASCRLEYHRSEESRMSIGGAQNA 173 MTV+EAKE CA WMKEALDAFVCQF +R EEE L SCRL RSE+ R+ I GAQ A Sbjct: 141 MTVSEAKEACAAAWMKEALDAFVCQF---KRVEEEQLTSCRLASCRSEDLRLCI-GAQTA 196 Query: 172 DEEVDYYLIS 143 +E+VD YLIS Sbjct: 197 EEDVDCYLIS 206 >ref|XP_011083132.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Sesamum indicum] Length = 208 Score = 81.6 bits (200), Expect = 2e-13 Identities = 45/71 (63%), Positives = 53/71 (74%), Gaps = 1/71 (1%) Frame = -2 Query: 352 MTVNEAKEVCAHWWMKEALDAFVCQFTCMQRKEEEPLA-SCRLEYHRSEESRMSIGGAQN 176 MT+NEA+E C+ WMKEAL+AFV QFT R EEE LA SCRL R+EE R+SI G+Q Sbjct: 139 MTINEAREACSQLWMKEALEAFVGQFTPRPRLEEEQLATSCRLALCRAEEIRLSI-GSQT 197 Query: 175 ADEEVDYYLIS 143 DE+VD YLIS Sbjct: 198 VDEDVDRYLIS 208