BLASTX nr result
ID: Forsythia21_contig00010271
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00010271 (246 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHB33870.1| sucrose transporter [Fraxinus excelsior] 65 2e-08 >gb|AHB33870.1| sucrose transporter [Fraxinus excelsior] Length = 517 Score = 64.7 bits (156), Expect = 2e-08 Identities = 34/45 (75%), Positives = 36/45 (80%), Gaps = 4/45 (8%) Frame = -3 Query: 124 MEVDGRKLSTVES----AQPQEPLRKLIPVASIAAGVQFGWALQL 2 MEVDG KLST+ PQEPLRKLIPVA+IAAGVQFGWALQL Sbjct: 1 MEVDGSKLSTIVPEPPLTPPQEPLRKLIPVAAIAAGVQFGWALQL 45