BLASTX nr result
ID: Forsythia21_contig00010247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00010247 (353 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007671550.1| hypothetical protein BAUCODRAFT_62350 [Baudo... 89 9e-16 gb|KEQ84745.1| 40S ribosomal protein S12 [Aureobasidium pullulan... 89 1e-15 gb|KEQ64850.1| L30e-like protein [Aureobasidium melanogenum CBS ... 89 1e-15 ref|XP_002480539.1| 40S ribosomal protein S12 [Talaromyces stipi... 89 1e-15 gb|EMF16803.1| 40S ribosomal protein S12 [Sphaerulina musiva SO2... 89 1e-15 ref|XP_007922222.1| hypothetical protein MYCFIDRAFT_193543 [Pseu... 89 1e-15 gb|EME50383.1| hypothetical protein DOTSEDRAFT_69040 [Dothistrom... 89 1e-15 dbj|BAK02932.1| predicted protein [Hordeum vulgare subsp. vulgare] 89 1e-15 dbj|GAO89669.1| 40S ribosomal protein S12 [Neosartorya udagawae] 89 1e-15 gb|KMK57211.1| histone deacetylase complex subunit (Hos4), putat... 89 1e-15 gb|KKK26436.1| hypothetical protein ARAM_004169 [Aspergillus ram... 89 1e-15 gb|KKK12279.1| hypothetical protein AOCH_005338 [Aspergillus och... 89 1e-15 ref|XP_002383207.1| 40S ribosomal protein S12 [Aspergillus flavu... 89 1e-15 gb|EYE94356.1| L30e-like protein [Aspergillus ruber CBS 135680] 89 1e-15 ref|XP_750299.1| 40S ribosomal protein S12 [Aspergillus fumigatu... 89 1e-15 dbj|BAE54863.1| unnamed protein product [Aspergillus oryzae RIB40] 89 1e-15 ref|XP_001398890.1| 40S ribosomal protein S12 [Aspergillus niger... 89 1e-15 ref|XP_001269615.1| 40S ribosomal protein S12 [Aspergillus clava... 89 1e-15 ref|XP_001212258.1| 40S ribosomal protein S12 [Aspergillus terre... 89 1e-15 gb|KKY28217.1| putative 40s ribosomal protein s12 [Diplodia seri... 88 2e-15 >ref|XP_007671550.1| hypothetical protein BAUCODRAFT_62350 [Baudoinia compniacensis UAMH 10762] gi|449304359|gb|EMD00366.1| hypothetical protein BAUCODRAFT_62350 [Baudoinia compniacensis UAMH 10762] gi|752279487|dbj|GAM84783.1| hypothetical protein ANO11243_027840 [fungal sp. No.11243] Length = 121 Score = 89.4 bits (220), Expect = 9e-16 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -3 Query: 351 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 229 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ Sbjct: 81 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 121 >gb|KEQ84745.1| 40S ribosomal protein S12 [Aureobasidium pullulans EXF-150] Length = 150 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 351 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 229 CQIDREGNARKVVNCSCVVVKDWGEESQERS+LLNYFQTEQ Sbjct: 110 CQIDREGNARKVVNCSCVVVKDWGEESQERSILLNYFQTEQ 150 >gb|KEQ64850.1| L30e-like protein [Aureobasidium melanogenum CBS 110374] gi|662518382|gb|KEQ75942.1| L30e-like protein [Aureobasidium namibiae CBS 147.97] gi|662534971|gb|KEQ92290.1| hypothetical protein AUEXF2481DRAFT_43069 [Aureobasidium subglaciale EXF-2481] Length = 121 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 351 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 229 CQIDREGNARKVVNCSCVVVKDWGEESQERS+LLNYFQTEQ Sbjct: 81 CQIDREGNARKVVNCSCVVVKDWGEESQERSILLNYFQTEQ 121 >ref|XP_002480539.1| 40S ribosomal protein S12 [Talaromyces stipitatus ATCC 10500] gi|218720686|gb|EED20105.1| 40S ribosomal protein S12 [Talaromyces stipitatus ATCC 10500] Length = 150 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 351 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 229 CQIDREGNARKVVNCSCVVVKDWGEESQERS+LLNYFQTEQ Sbjct: 110 CQIDREGNARKVVNCSCVVVKDWGEESQERSILLNYFQTEQ 150 >gb|EMF16803.1| 40S ribosomal protein S12 [Sphaerulina musiva SO2202] Length = 149 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 351 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 229 CQIDREGNARKVVNCSCVVVKDWGEESQERS+LLNYFQTEQ Sbjct: 109 CQIDREGNARKVVNCSCVVVKDWGEESQERSILLNYFQTEQ 149 >ref|XP_007922222.1| hypothetical protein MYCFIDRAFT_193543 [Pseudocercospora fijiensis CIRAD86] gi|452989939|gb|EME89694.1| hypothetical protein MYCFIDRAFT_193543 [Pseudocercospora fijiensis CIRAD86] Length = 149 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 351 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 229 CQIDREGNARKVVNCSCVVVKDWGEESQERS+LLNYFQTEQ Sbjct: 109 CQIDREGNARKVVNCSCVVVKDWGEESQERSILLNYFQTEQ 149 >gb|EME50383.1| hypothetical protein DOTSEDRAFT_69040 [Dothistroma septosporum NZE10] Length = 150 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 351 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 229 CQIDREGNARKVVNCSCVVVKDWGEESQERS+LLNYFQTEQ Sbjct: 110 CQIDREGNARKVVNCSCVVVKDWGEESQERSILLNYFQTEQ 150 >dbj|BAK02932.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 149 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 351 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 229 CQIDREGNARKVVNCSCVVVKDWGEESQERS+LLNYFQTEQ Sbjct: 109 CQIDREGNARKVVNCSCVVVKDWGEESQERSILLNYFQTEQ 149 >dbj|GAO89669.1| 40S ribosomal protein S12 [Neosartorya udagawae] Length = 151 Score = 88.6 bits (218), Expect = 1e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 351 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 229 CQ+DREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ Sbjct: 111 CQLDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 151 >gb|KMK57211.1| histone deacetylase complex subunit (Hos4), putative [Aspergillus fumigatus Z5] Length = 1470 Score = 88.6 bits (218), Expect = 1e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 351 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 229 CQ+DREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ Sbjct: 1430 CQLDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 1470 >gb|KKK26436.1| hypothetical protein ARAM_004169 [Aspergillus rambellii] Length = 1489 Score = 88.6 bits (218), Expect = 1e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 351 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 229 CQ+DREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ Sbjct: 1449 CQLDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 1489 >gb|KKK12279.1| hypothetical protein AOCH_005338 [Aspergillus ochraceoroseus] Length = 1493 Score = 88.6 bits (218), Expect = 1e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 351 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 229 CQ+DREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ Sbjct: 1453 CQLDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 1493 >ref|XP_002383207.1| 40S ribosomal protein S12 [Aspergillus flavus NRRL3357] gi|317138379|ref|XP_001816865.2| 40S ribosomal protein S12 [Aspergillus oryzae RIB40] gi|220690678|gb|EED47027.1| 40S ribosomal protein S12 [Aspergillus flavus NRRL3357] gi|391863428|gb|EIT72739.1| 40S ribosomal protein [Aspergillus oryzae 3.042] gi|635505547|gb|KDE77612.1| 40S ribosomal protein [Aspergillus oryzae 100-8] gi|770304405|gb|KJK62392.1| Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein [Aspergillus parasiticus SU-1] Length = 150 Score = 88.6 bits (218), Expect = 1e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 351 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 229 CQ+DREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ Sbjct: 110 CQLDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 150 >gb|EYE94356.1| L30e-like protein [Aspergillus ruber CBS 135680] Length = 150 Score = 88.6 bits (218), Expect = 1e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 351 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 229 CQ+DREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ Sbjct: 110 CQLDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 150 >ref|XP_750299.1| 40S ribosomal protein S12 [Aspergillus fumigatus Af293] gi|119496693|ref|XP_001265120.1| 40S ribosomal protein S12 [Neosartorya fischeri NRRL 181] gi|66847931|gb|EAL88261.1| 40S ribosomal protein S12 [Aspergillus fumigatus Af293] gi|119413282|gb|EAW23223.1| 40S ribosomal protein S12 [Neosartorya fischeri NRRL 181] gi|159130771|gb|EDP55884.1| 40S ribosomal protein S12 [Aspergillus fumigatus A1163] gi|666432805|gb|KEY80376.1| 40S ribosomal protein S12 [Aspergillus fumigatus var. RP-2014] Length = 144 Score = 88.6 bits (218), Expect = 1e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 351 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 229 CQ+DREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ Sbjct: 104 CQLDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 144 >dbj|BAE54863.1| unnamed protein product [Aspergillus oryzae RIB40] Length = 121 Score = 88.6 bits (218), Expect = 1e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 351 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 229 CQ+DREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ Sbjct: 81 CQLDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 121 >ref|XP_001398890.1| 40S ribosomal protein S12 [Aspergillus niger CBS 513.88] gi|134084480|emb|CAK43234.1| unnamed protein product [Aspergillus niger] gi|358366816|dbj|GAA83436.1| 40S ribosomal protein S12 [Aspergillus kawachii IFO 4308] Length = 150 Score = 88.6 bits (218), Expect = 1e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 351 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 229 CQ+DREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ Sbjct: 110 CQLDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 150 >ref|XP_001269615.1| 40S ribosomal protein S12 [Aspergillus clavatus NRRL 1] gi|119397758|gb|EAW08189.1| 40S ribosomal protein S12 [Aspergillus clavatus NRRL 1] Length = 144 Score = 88.6 bits (218), Expect = 1e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 351 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 229 CQ+DREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ Sbjct: 104 CQLDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 144 >ref|XP_001212258.1| 40S ribosomal protein S12 [Aspergillus terreus NIH2624] gi|114194654|gb|EAU36354.1| 40S ribosomal protein S12 [Aspergillus terreus NIH2624] Length = 151 Score = 88.6 bits (218), Expect = 1e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 351 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 229 CQ+DREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ Sbjct: 111 CQLDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 151 >gb|KKY28217.1| putative 40s ribosomal protein s12 [Diplodia seriata] Length = 148 Score = 87.8 bits (216), Expect = 2e-15 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -3 Query: 351 CQIDREGNARKVVNCSCVVVKDWGEESQERSVLLNYFQTEQ 229 CQIDREGNARKVVNCSCVVVKDWGEESQER++LLNYFQTEQ Sbjct: 108 CQIDREGNARKVVNCSCVVVKDWGEESQERNILLNYFQTEQ 148