BLASTX nr result
ID: Forsythia21_contig00010028
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00010028 (507 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ77552.1| ribosomal protein S13 [Aureobasidium namibiae CBS... 100 4e-19 gb|KEQ67331.1| ribosomal protein S13 [Aureobasidium melanogenum ... 100 5e-19 gb|KKY26940.1| putative 40s ribosomal protein s18 [Diplodia seri... 99 8e-19 ref|XP_003855088.1| 40S ribosomal protein S18 [Zymoseptoria trit... 99 8e-19 dbj|GAM87422.1| hypothetical protein ANO11243_054460 [fungal sp.... 99 1e-18 gb|EKG12572.1| Ribosomal protein S13 [Macrophomina phaseolina MS6] 99 1e-18 ref|XP_007587552.1| putative 40s ribosomal protein s18 protein [... 98 2e-18 ref|XP_007680706.1| hypothetical protein BAUCODRAFT_126295 [Baud... 98 2e-18 gb|ELU39326.1| 40s ribosomal protein [Rhizoctonia solani AG-1 IA] 89 3e-18 gb|KJZ79014.1| 40S ribosomal protein S18 [Hirsutella minnesotens... 97 3e-18 emb|CCX06883.1| Similar to 40S ribosomal protein S18-A; acc. no.... 97 3e-18 gb|EQL02096.1| 40S ribosomal protein S18 [Ophiocordyceps sinensi... 97 3e-18 gb|KDB13450.1| 40S ribosomal protein S18 [Ustilaginoidea virens]... 97 4e-18 emb|CCU80425.1| 40S ribosomal protein S18 [Blumeria graminis f. ... 97 4e-18 gb|EPQ62680.1| Protein component of the small (40S) ribosomal su... 97 4e-18 ref|XP_007917081.1| putative 40s ribosomal protein s18 protein [... 97 4e-18 ref|XP_007289121.1| 40S ribosomal protein S18 [Marssonina brunne... 97 4e-18 ref|XP_006693104.1| putative ribosomal protein [Chaetomium therm... 97 4e-18 gb|KKY38880.1| putative 40s ribosomal protein s18 [Diaporthe amp... 96 7e-18 ref|XP_007834807.1| 40S ribosomal protein S18 [Pestalotiopsis fi... 96 7e-18 >gb|KEQ77552.1| ribosomal protein S13 [Aureobasidium namibiae CBS 147.97] gi|662525546|gb|KEQ82930.1| ribosomal protein S13 [Aureobasidium pullulans EXF-150] gi|662536607|gb|KEQ93919.1| hypothetical protein AUEXF2481DRAFT_6489 [Aureobasidium subglaciale EXF-2481] Length = 154 Score = 100 bits (249), Expect = 4e-19 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = +2 Query: 2 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 142 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 91 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 137 >gb|KEQ67331.1| ribosomal protein S13 [Aureobasidium melanogenum CBS 110374] Length = 154 Score = 100 bits (248), Expect = 5e-19 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 2 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 142 DIVDGKDFQ+LANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 91 DIVDGKDFQILANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 137 >gb|KKY26940.1| putative 40s ribosomal protein s18 [Diplodia seriata] Length = 155 Score = 99.4 bits (246), Expect = 8e-19 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 2 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 142 DIVDGKD+QVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 91 DIVDGKDYQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 137 >ref|XP_003855088.1| 40S ribosomal protein S18 [Zymoseptoria tritici IPO323] gi|339474972|gb|EGP90064.1| hypothetical protein MYCGRDRAFT_55708 [Zymoseptoria tritici IPO323] gi|796705215|gb|KJX96969.1| 40s ribosomal protein s18 [Zymoseptoria brevis] Length = 155 Score = 99.4 bits (246), Expect = 8e-19 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 2 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 142 DIVDGKD+QVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 91 DIVDGKDYQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 137 >dbj|GAM87422.1| hypothetical protein ANO11243_054460 [fungal sp. No.11243] Length = 158 Score = 99.0 bits (245), Expect = 1e-18 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = +2 Query: 2 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 142 DIVDGKDFQ+LANGVDSKLR+DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 94 DIVDGKDFQILANGVDSKLRDDLERLKKIRAHRGLRHYWGLRVRGQH 140 >gb|EKG12572.1| Ribosomal protein S13 [Macrophomina phaseolina MS6] Length = 155 Score = 99.0 bits (245), Expect = 1e-18 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = +2 Query: 2 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 142 DIVDGKD+Q+LANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 91 DIVDGKDYQILANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 137 >ref|XP_007587552.1| putative 40s ribosomal protein s18 protein [Neofusicoccum parvum UCRNP2] gi|485918262|gb|EOD44952.1| putative 40s ribosomal protein s18 protein [Neofusicoccum parvum UCRNP2] Length = 155 Score = 98.2 bits (243), Expect = 2e-18 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = +2 Query: 2 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 142 DIVDGKD+QVLANGVDSKLR+DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 91 DIVDGKDYQVLANGVDSKLRDDLERLKKIRAHRGLRHYWGLRVRGQH 137 >ref|XP_007680706.1| hypothetical protein BAUCODRAFT_126295 [Baudoinia compniacensis UAMH 10762] gi|449296287|gb|EMC92307.1| hypothetical protein BAUCODRAFT_126295 [Baudoinia compniacensis UAMH 10762] Length = 155 Score = 97.8 bits (242), Expect = 2e-18 Identities = 44/47 (93%), Positives = 47/47 (100%) Frame = +2 Query: 2 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 142 DIVDGKD+Q+LANGVDSKLR+DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 91 DIVDGKDYQILANGVDSKLRDDLERLKKIRAHRGLRHYWGLRVRGQH 137 >gb|ELU39326.1| 40s ribosomal protein [Rhizoctonia solani AG-1 IA] Length = 376 Score = 89.4 bits (220), Expect(2) = 3e-18 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = +2 Query: 2 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 142 DIVDGK+ Q+L+N +DSK+R+DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 92 DIVDGKNSQILSNAIDSKMRDDLERLKKIRAHRGLRHYWGLRVRGQH 138 Score = 28.9 bits (63), Expect(2) = 3e-18 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +1 Query: 154 RPSRQDRWCQQEEGL 198 RPSR+DR C QEEGL Sbjct: 159 RPSREDRRCLQEEGL 173 >gb|KJZ79014.1| 40S ribosomal protein S18 [Hirsutella minnesotensis 3608] Length = 156 Score = 97.4 bits (241), Expect = 3e-18 Identities = 46/47 (97%), Positives = 46/47 (97%) Frame = +2 Query: 2 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 142 DIVDGKD QVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 91 DIVDGKDSQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 137 >emb|CCX06883.1| Similar to 40S ribosomal protein S18-A; acc. no. P0CX55 [Pyronema omphalodes CBS 100304] Length = 127 Score = 97.4 bits (241), Expect = 3e-18 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +2 Query: 2 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 142 DIVDGKD+Q+LANGVDSKLREDLERLKKIR HRGLRHYWGLRVRGQH Sbjct: 63 DIVDGKDYQILANGVDSKLREDLERLKKIRCHRGLRHYWGLRVRGQH 109 >gb|EQL02096.1| 40S ribosomal protein S18 [Ophiocordyceps sinensis CO18] Length = 156 Score = 97.4 bits (241), Expect = 3e-18 Identities = 46/47 (97%), Positives = 46/47 (97%) Frame = +2 Query: 2 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 142 DIVDGKD QVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 91 DIVDGKDSQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 137 >gb|KDB13450.1| 40S ribosomal protein S18 [Ustilaginoidea virens] gi|781087821|dbj|GAO13868.1| hypothetical protein UVI_008830 [Ustilaginoidea virens] Length = 156 Score = 97.1 bits (240), Expect = 4e-18 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +2 Query: 2 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 142 DIVDGKD Q+LANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 91 DIVDGKDSQILANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 137 >emb|CCU80425.1| 40S ribosomal protein S18 [Blumeria graminis f. sp. hordei DH14] Length = 151 Score = 97.1 bits (240), Expect = 4e-18 Identities = 44/47 (93%), Positives = 47/47 (100%) Frame = +2 Query: 2 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 142 DIVDGK++Q+LANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 86 DIVDGKNYQILANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 132 >gb|EPQ62680.1| Protein component of the small (40S) ribosomal subunit [Blumeria graminis f. sp. tritici 96224] Length = 128 Score = 97.1 bits (240), Expect = 4e-18 Identities = 44/47 (93%), Positives = 47/47 (100%) Frame = +2 Query: 2 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 142 DI+DGK++QVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 63 DIIDGKNYQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 109 >ref|XP_007917081.1| putative 40s ribosomal protein s18 protein [Togninia minima UCRPA7] gi|500254481|gb|EON98077.1| putative 40s ribosomal protein s18 protein [Togninia minima UCRPA7] Length = 151 Score = 97.1 bits (240), Expect = 4e-18 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +2 Query: 2 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 142 DIVDGKD Q+LANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 86 DIVDGKDSQILANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 132 >ref|XP_007289121.1| 40S ribosomal protein S18 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406867512|gb|EKD20550.1| 40S ribosomal protein S18 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 123 Score = 97.1 bits (240), Expect = 4e-18 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +2 Query: 2 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 142 DIVDGKD Q+LANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 58 DIVDGKDSQILANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 104 >ref|XP_006693104.1| putative ribosomal protein [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340959627|gb|EGS20808.1| putative ribosomal protein [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 156 Score = 97.1 bits (240), Expect = 4e-18 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +2 Query: 2 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 142 DIVDGKD Q+LANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 91 DIVDGKDSQILANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 137 >gb|KKY38880.1| putative 40s ribosomal protein s18 [Diaporthe ampelina] Length = 156 Score = 96.3 bits (238), Expect = 7e-18 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +2 Query: 2 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 142 DIVDGKD QVLANGVDSKLR+DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 91 DIVDGKDSQVLANGVDSKLRDDLERLKKIRAHRGLRHYWGLRVRGQH 137 >ref|XP_007834807.1| 40S ribosomal protein S18 [Pestalotiopsis fici W106-1] gi|573060744|gb|ETS80506.1| 40S ribosomal protein S18 [Pestalotiopsis fici W106-1] Length = 156 Score = 96.3 bits (238), Expect = 7e-18 Identities = 44/47 (93%), Positives = 47/47 (100%) Frame = +2 Query: 2 DIVDGKDFQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQH 142 DIVDGK++QVLANGVDSKLR+DLERLKKIRAHRGLRHYWGLRVRGQH Sbjct: 91 DIVDGKNYQVLANGVDSKLRDDLERLKKIRAHRGLRHYWGLRVRGQH 137