BLASTX nr result
ID: Forsythia21_contig00007807
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00007807 (252 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089674.1| PREDICTED: ankyrin repeat and SAM domain-con... 59 2e-06 gb|EYU39200.1| hypothetical protein MIMGU_mgv1a021706mg [Erythra... 56 8e-06 >ref|XP_011089674.1| PREDICTED: ankyrin repeat and SAM domain-containing protein 6-like [Sesamum indicum] Length = 212 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 109 MYADRVEIQAKRSVKERLIGNLISDSGRRRPVSGKR 2 MYADRVE QA RS+KERL GN DSGRRRP+SGKR Sbjct: 1 MYADRVEAQANRSIKERLNGNSAVDSGRRRPISGKR 36 >gb|EYU39200.1| hypothetical protein MIMGU_mgv1a021706mg [Erythranthe guttata] Length = 190 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -3 Query: 109 MYADRVEIQAKRSVKERLIGNLISDSGRRRPVSGKR 2 MYAD+VE QA RSVK+RL GN S+SGRRRP+SGKR Sbjct: 1 MYADQVESQANRSVKDRLNGNSASNSGRRRPISGKR 36