BLASTX nr result
ID: Forsythia21_contig00007670
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00007670 (413 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007041957.1| Pentatricopeptide repeat-containing protein,... 58 3e-06 gb|KHF99163.1| Pentatricopeptide repeat-containing protein [Goss... 57 4e-06 gb|KHF99162.1| Pentatricopeptide repeat-containing protein, chlo... 57 4e-06 ref|XP_012442077.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 ref|XP_012442074.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 ref|XP_012442072.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 >ref|XP_007041957.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508705892|gb|EOX97788.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 1110 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 411 PFRGKPTDMNSSQARLGRGIIHQQRNIRTGNLSLE 307 PF GKP + N+SQ RLG+GI HQQRNIRTGNLSL+ Sbjct: 1076 PFTGKPGEWNASQMRLGKGISHQQRNIRTGNLSLD 1110 >gb|KHF99163.1| Pentatricopeptide repeat-containing protein [Gossypium arboreum] Length = 1178 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -3 Query: 411 PFRGKPTDMNSSQARLGRGIIHQQRNIRTGNLSLE*E 301 PF GKP + N+SQ RLG+GI HQQRNIRTGNLSL E Sbjct: 1142 PFTGKPGEWNASQMRLGKGISHQQRNIRTGNLSLHQE 1178 >gb|KHF99162.1| Pentatricopeptide repeat-containing protein, chloroplastic [Gossypium arboreum] Length = 1189 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -3 Query: 411 PFRGKPTDMNSSQARLGRGIIHQQRNIRTGNLSLE*E 301 PF GKP + N+SQ RLG+GI HQQRNIRTGNLSL E Sbjct: 1153 PFTGKPGEWNASQMRLGKGISHQQRNIRTGNLSLHQE 1189 >ref|XP_012442077.1| PREDICTED: pentatricopeptide repeat-containing protein MRL1, chloroplastic isoform X3 [Gossypium raimondii] Length = 998 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 411 PFRGKPTDMNSSQARLGRGIIHQQRNIRTGNLSL 310 PF GKP + N+SQ RLG+GI HQQRNIRTGNLSL Sbjct: 964 PFTGKPGEWNASQMRLGKGISHQQRNIRTGNLSL 997 >ref|XP_012442074.1| PREDICTED: pentatricopeptide repeat-containing protein MRL1, chloroplastic isoform X2 [Gossypium raimondii] Length = 1073 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 411 PFRGKPTDMNSSQARLGRGIIHQQRNIRTGNLSL 310 PF GKP + N+SQ RLG+GI HQQRNIRTGNLSL Sbjct: 1039 PFTGKPGEWNASQMRLGKGISHQQRNIRTGNLSL 1072 >ref|XP_012442072.1| PREDICTED: pentatricopeptide repeat-containing protein MRL1, chloroplastic isoform X1 [Gossypium raimondii] gi|763743696|gb|KJB11195.1| hypothetical protein B456_001G246900 [Gossypium raimondii] Length = 1106 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 411 PFRGKPTDMNSSQARLGRGIIHQQRNIRTGNLSL 310 PF GKP + N+SQ RLG+GI HQQRNIRTGNLSL Sbjct: 1072 PFTGKPGEWNASQMRLGKGISHQQRNIRTGNLSL 1105