BLASTX nr result
ID: Forsythia21_contig00007585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00007585 (1093 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009801912.1| PREDICTED: methionine aminopeptidase 2B-like... 76 4e-11 ref|XP_009614888.1| PREDICTED: methionine aminopeptidase 2B {ECO... 76 4e-11 emb|CDP19082.1| unnamed protein product [Coffea canephora] 76 4e-11 gb|KJB42878.1| hypothetical protein B456_007G172000 [Gossypium r... 76 5e-11 ref|XP_012491143.1| PREDICTED: methionine aminopeptidase 2B-like... 76 5e-11 ref|XP_012491144.1| PREDICTED: methionine aminopeptidase 2B-like... 76 5e-11 ref|XP_011074032.1| PREDICTED: methionine aminopeptidase 2B [Ses... 76 5e-11 gb|KHG03523.1| Methionine aminopeptidase 2B -like protein [Gossy... 76 5e-11 ref|XP_008234506.1| PREDICTED: methionine aminopeptidase 2B-like... 76 5e-11 ref|XP_012081872.1| PREDICTED: methionine aminopeptidase 2B [Jat... 76 5e-11 gb|KDO46913.1| hypothetical protein CISIN_1g014386mg [Citrus sin... 76 5e-11 gb|ADE77044.1| unknown [Picea sitchensis] 76 5e-11 ref|XP_002529218.1| methionine aminopeptidase, putative [Ricinus... 76 5e-11 ref|XP_006478515.1| PREDICTED: methionine aminopeptidase 2B-like... 76 5e-11 ref|XP_006441966.1| hypothetical protein CICLE_v10020270mg [Citr... 76 5e-11 ref|XP_010094105.1| Methionine aminopeptidase 2B [Morus notabili... 75 6e-11 ref|XP_011002199.1| PREDICTED: methionine aminopeptidase 2B-like... 75 6e-11 ref|XP_009405021.1| PREDICTED: methionine aminopeptidase 2B-like... 75 6e-11 ref|XP_009341530.1| PREDICTED: methionine aminopeptidase 2B-like... 75 6e-11 ref|XP_009341528.1| PREDICTED: methionine aminopeptidase 2B-like... 75 6e-11 >ref|XP_009801912.1| PREDICTED: methionine aminopeptidase 2B-like [Nicotiana sylvestris] Length = 433 Score = 76.3 bits (186), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 1093 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 992 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY Sbjct: 400 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 433 >ref|XP_009614888.1| PREDICTED: methionine aminopeptidase 2B {ECO:0000255|HAMAP-Rule:MF_03175}-like [Nicotiana tomentosiformis] gi|697121816|ref|XP_009614889.1| PREDICTED: methionine aminopeptidase 2B {ECO:0000255|HAMAP-Rule:MF_03175}-like [Nicotiana tomentosiformis] gi|697121818|ref|XP_009614890.1| PREDICTED: methionine aminopeptidase 2B {ECO:0000255|HAMAP-Rule:MF_03175}-like [Nicotiana tomentosiformis] Length = 433 Score = 76.3 bits (186), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 1093 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 992 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY Sbjct: 400 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 433 >emb|CDP19082.1| unnamed protein product [Coffea canephora] Length = 426 Score = 76.3 bits (186), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 1093 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 992 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY Sbjct: 393 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 426 >gb|KJB42878.1| hypothetical protein B456_007G172000 [Gossypium raimondii] Length = 394 Score = 75.9 bits (185), Expect = 5e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 1093 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 992 PPLCDIKGSYVSQFEHTILLRPTCKEV+SRGDDY Sbjct: 361 PPLCDIKGSYVSQFEHTILLRPTCKEVISRGDDY 394 >ref|XP_012491143.1| PREDICTED: methionine aminopeptidase 2B-like isoform X1 [Gossypium raimondii] gi|763775754|gb|KJB42877.1| hypothetical protein B456_007G172000 [Gossypium raimondii] Length = 434 Score = 75.9 bits (185), Expect = 5e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 1093 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 992 PPLCDIKGSYVSQFEHTILLRPTCKEV+SRGDDY Sbjct: 401 PPLCDIKGSYVSQFEHTILLRPTCKEVISRGDDY 434 >ref|XP_012491144.1| PREDICTED: methionine aminopeptidase 2B-like isoform X2 [Gossypium raimondii] gi|763775753|gb|KJB42876.1| hypothetical protein B456_007G172000 [Gossypium raimondii] Length = 433 Score = 75.9 bits (185), Expect = 5e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 1093 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 992 PPLCDIKGSYVSQFEHTILLRPTCKEV+SRGDDY Sbjct: 400 PPLCDIKGSYVSQFEHTILLRPTCKEVISRGDDY 433 >ref|XP_011074032.1| PREDICTED: methionine aminopeptidase 2B [Sesamum indicum] Length = 426 Score = 75.9 bits (185), Expect = 5e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 1093 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 992 PPLCD+KGSYVSQFEHTILLRPTCKEVVSRGDDY Sbjct: 393 PPLCDVKGSYVSQFEHTILLRPTCKEVVSRGDDY 426 >gb|KHG03523.1| Methionine aminopeptidase 2B -like protein [Gossypium arboreum] Length = 436 Score = 75.9 bits (185), Expect = 5e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 1093 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 992 PPLCDIKGSYVSQFEHTILLRPTCKEV+SRGDDY Sbjct: 403 PPLCDIKGSYVSQFEHTILLRPTCKEVISRGDDY 436 >ref|XP_008234506.1| PREDICTED: methionine aminopeptidase 2B-like [Prunus mume] gi|645257651|ref|XP_008234507.1| PREDICTED: methionine aminopeptidase 2B-like [Prunus mume] Length = 435 Score = 75.9 bits (185), Expect = 5e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 1093 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 992 PPLCD+KGSYVSQFEHTILLRPTCKEVVSRGDDY Sbjct: 402 PPLCDVKGSYVSQFEHTILLRPTCKEVVSRGDDY 435 >ref|XP_012081872.1| PREDICTED: methionine aminopeptidase 2B [Jatropha curcas] gi|643718235|gb|KDP29524.1| hypothetical protein JCGZ_19237 [Jatropha curcas] Length = 432 Score = 75.9 bits (185), Expect = 5e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 1093 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 992 PPLCDIKGSYVSQFEHTILLRPTCKEV+SRGDDY Sbjct: 399 PPLCDIKGSYVSQFEHTILLRPTCKEVISRGDDY 432 >gb|KDO46913.1| hypothetical protein CISIN_1g014386mg [Citrus sinensis] Length = 425 Score = 75.9 bits (185), Expect = 5e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 1093 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 992 PPLCDIKGSYVSQFEHTILLRPTCKEV+SRGDDY Sbjct: 392 PPLCDIKGSYVSQFEHTILLRPTCKEVISRGDDY 425 >gb|ADE77044.1| unknown [Picea sitchensis] Length = 476 Score = 75.9 bits (185), Expect = 5e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 1093 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 992 PPLCDIKGSYVSQFEHTILLRPTCKEV+SRGDDY Sbjct: 443 PPLCDIKGSYVSQFEHTILLRPTCKEVISRGDDY 476 >ref|XP_002529218.1| methionine aminopeptidase, putative [Ricinus communis] gi|223531336|gb|EEF33174.1| methionine aminopeptidase, putative [Ricinus communis] Length = 432 Score = 75.9 bits (185), Expect = 5e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 1093 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 992 PPLCDIKGSYVSQFEHTILLRPTCKEV+SRGDDY Sbjct: 399 PPLCDIKGSYVSQFEHTILLRPTCKEVISRGDDY 432 >ref|XP_006478515.1| PREDICTED: methionine aminopeptidase 2B-like [Citrus sinensis] Length = 425 Score = 75.9 bits (185), Expect = 5e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 1093 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 992 PPLCDIKGSYVSQFEHTILLRPTCKEV+SRGDDY Sbjct: 392 PPLCDIKGSYVSQFEHTILLRPTCKEVISRGDDY 425 >ref|XP_006441966.1| hypothetical protein CICLE_v10020270mg [Citrus clementina] gi|557544228|gb|ESR55206.1| hypothetical protein CICLE_v10020270mg [Citrus clementina] Length = 425 Score = 75.9 bits (185), Expect = 5e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 1093 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 992 PPLCDIKGSYVSQFEHTILLRPTCKEV+SRGDDY Sbjct: 392 PPLCDIKGSYVSQFEHTILLRPTCKEVISRGDDY 425 >ref|XP_010094105.1| Methionine aminopeptidase 2B [Morus notabilis] gi|587865665|gb|EXB55195.1| Methionine aminopeptidase 2B [Morus notabilis] Length = 395 Score = 75.5 bits (184), Expect = 6e-11 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 1093 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 992 PPLCD+KGSYVSQFEHTILLRPTCKEV+SRGDDY Sbjct: 362 PPLCDVKGSYVSQFEHTILLRPTCKEVISRGDDY 395 >ref|XP_011002199.1| PREDICTED: methionine aminopeptidase 2B-like [Populus euphratica] gi|743916446|ref|XP_011002200.1| PREDICTED: methionine aminopeptidase 2B-like [Populus euphratica] gi|743916448|ref|XP_011002201.1| PREDICTED: methionine aminopeptidase 2B-like [Populus euphratica] gi|743916450|ref|XP_011002202.1| PREDICTED: methionine aminopeptidase 2B-like [Populus euphratica] gi|743916452|ref|XP_011002203.1| PREDICTED: methionine aminopeptidase 2B-like [Populus euphratica] Length = 440 Score = 75.5 bits (184), Expect = 6e-11 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 1093 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 992 PPLCD+KGSYVSQFEHTILLRPTCKEV+SRGDDY Sbjct: 407 PPLCDVKGSYVSQFEHTILLRPTCKEVISRGDDY 440 >ref|XP_009405021.1| PREDICTED: methionine aminopeptidase 2B-like [Musa acuminata subsp. malaccensis] gi|695035104|ref|XP_009405023.1| PREDICTED: methionine aminopeptidase 2B-like [Musa acuminata subsp. malaccensis] Length = 453 Score = 75.5 bits (184), Expect = 6e-11 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 1093 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 992 PPLCD+KGSYVSQFEHTILLRPTCKEV+SRGDDY Sbjct: 420 PPLCDVKGSYVSQFEHTILLRPTCKEVISRGDDY 453 >ref|XP_009341530.1| PREDICTED: methionine aminopeptidase 2B-like isoform X2 [Pyrus x bretschneideri] Length = 434 Score = 75.5 bits (184), Expect = 6e-11 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 1093 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 992 PPLCD+KGSYVSQFEHTILLRPTCKEV+SRGDDY Sbjct: 401 PPLCDVKGSYVSQFEHTILLRPTCKEVISRGDDY 434 >ref|XP_009341528.1| PREDICTED: methionine aminopeptidase 2B-like isoform X1 [Pyrus x bretschneideri] Length = 435 Score = 75.5 bits (184), Expect = 6e-11 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 1093 PPLCDIKGSYVSQFEHTILLRPTCKEVVSRGDDY 992 PPLCD+KGSYVSQFEHTILLRPTCKEV+SRGDDY Sbjct: 402 PPLCDVKGSYVSQFEHTILLRPTCKEVISRGDDY 435