BLASTX nr result
ID: Forsythia21_contig00005737
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00005737 (429 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094928.1| PREDICTED: probable proteasome inhibitor [Se... 94 3e-17 ref|XP_010088550.1| hypothetical protein L484_016942 [Morus nota... 93 8e-17 ref|XP_011653658.1| PREDICTED: probable proteasome inhibitor [Cu... 92 1e-16 ref|XP_008448539.1| PREDICTED: probable proteasome inhibitor [Cu... 92 1e-16 ref|XP_010037783.1| PREDICTED: probable proteasome inhibitor [Eu... 92 1e-16 ref|XP_008359767.1| PREDICTED: probable proteasome inhibitor [Ma... 92 2e-16 ref|XP_008240153.1| PREDICTED: probable proteasome inhibitor [Pr... 91 2e-16 ref|XP_009378874.1| PREDICTED: probable proteasome inhibitor [Py... 91 4e-16 ref|XP_009378857.1| PREDICTED: probable proteasome inhibitor [Py... 91 4e-16 emb|CDP06558.1| unnamed protein product [Coffea canephora] 91 4e-16 ref|XP_012087979.1| PREDICTED: probable proteasome inhibitor [Ja... 90 5e-16 ref|XP_009358792.1| PREDICTED: probable proteasome inhibitor [Py... 90 7e-16 ref|XP_007026871.1| Proteasome inhibitor-related [Theobroma caca... 89 1e-15 ref|XP_007205609.1| hypothetical protein PRUPE_ppa009070mg [Prun... 88 2e-15 ref|XP_002275006.1| PREDICTED: probable proteasome inhibitor [Vi... 88 2e-15 ref|XP_012832066.1| PREDICTED: probable proteasome inhibitor [Er... 88 3e-15 ref|XP_010325823.1| PREDICTED: probable proteasome inhibitor iso... 87 3e-15 ref|XP_006340975.1| PREDICTED: probable proteasome inhibitor-lik... 87 3e-15 ref|XP_006340974.1| PREDICTED: probable proteasome inhibitor-lik... 87 3e-15 ref|XP_004246392.1| PREDICTED: probable proteasome inhibitor iso... 87 3e-15 >ref|XP_011094928.1| PREDICTED: probable proteasome inhibitor [Sesamum indicum] Length = 300 Score = 94.4 bits (233), Expect = 3e-17 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -3 Query: 364 ARFDPYGPPGVPGFEPGRFVRNPRRPGGGTHPDLEHFGSDTDFI 233 ARFDPYGPPGVPGFEPGRFVRNPRRPGGGTHPDLEHF +DFI Sbjct: 257 ARFDPYGPPGVPGFEPGRFVRNPRRPGGGTHPDLEHFHDGSDFI 300 >ref|XP_010088550.1| hypothetical protein L484_016942 [Morus notabilis] gi|587846171|gb|EXB36691.1| hypothetical protein L484_016942 [Morus notabilis] Length = 301 Score = 92.8 bits (229), Expect = 8e-17 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -3 Query: 364 ARFDPYGPPGVPGFEPGRFVRNPRRPGGGTHPDLEHFGSDTDFI 233 ARFDPYGPPGVPGFEPGRF R PRRPG GTHPDLEHFGS +DFI Sbjct: 258 ARFDPYGPPGVPGFEPGRFARGPRRPGSGTHPDLEHFGSGSDFI 301 >ref|XP_011653658.1| PREDICTED: probable proteasome inhibitor [Cucumis sativus] gi|700199151|gb|KGN54309.1| hypothetical protein Csa_4G303080 [Cucumis sativus] Length = 318 Score = 92.4 bits (228), Expect = 1e-16 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -3 Query: 364 ARFDPYGPPGVPGFEPGRFVRNPRRPGGGTHPDLEHFGSDTDFI 233 ARFDPYGPP VPGFEP RFVRNPRRPGGGTHPDLEHFG +DFI Sbjct: 275 ARFDPYGPPDVPGFEPNRFVRNPRRPGGGTHPDLEHFGGGSDFI 318 >ref|XP_008448539.1| PREDICTED: probable proteasome inhibitor [Cucumis melo] Length = 318 Score = 92.4 bits (228), Expect = 1e-16 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -3 Query: 364 ARFDPYGPPGVPGFEPGRFVRNPRRPGGGTHPDLEHFGSDTDFI 233 ARFDPYGPP VPGFEP RFVRNPRRPGGGTHPDLEHFG +DFI Sbjct: 275 ARFDPYGPPDVPGFEPNRFVRNPRRPGGGTHPDLEHFGGGSDFI 318 >ref|XP_010037783.1| PREDICTED: probable proteasome inhibitor [Eucalyptus grandis] gi|629083073|gb|KCW49518.1| hypothetical protein EUGRSUZ_K03043 [Eucalyptus grandis] Length = 304 Score = 92.0 bits (227), Expect = 1e-16 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -3 Query: 364 ARFDPYGPPGVPGFEPGRFVRNPRRPGGGTHPDLEHFGSDTDFI 233 ARFDPYGPPGVPGFEPGRFVRNPRRPG GTHPDLEHF +DFI Sbjct: 261 ARFDPYGPPGVPGFEPGRFVRNPRRPGSGTHPDLEHFRDGSDFI 304 >ref|XP_008359767.1| PREDICTED: probable proteasome inhibitor [Malus domestica] Length = 306 Score = 91.7 bits (226), Expect = 2e-16 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -3 Query: 364 ARFDPYGPPGVPGFEPGRFVRNPRRPGGGTHPDLEHFGSDTDFI 233 ARFDPYGPPGVPGFE RF RNPRRPGGGTHPDLEHFGS +DFI Sbjct: 263 ARFDPYGPPGVPGFERNRFARNPRRPGGGTHPDLEHFGSGSDFI 306 >ref|XP_008240153.1| PREDICTED: probable proteasome inhibitor [Prunus mume] Length = 307 Score = 91.3 bits (225), Expect = 2e-16 Identities = 38/44 (86%), Positives = 39/44 (88%) Frame = -3 Query: 364 ARFDPYGPPGVPGFEPGRFVRNPRRPGGGTHPDLEHFGSDTDFI 233 ARFDPYGPPGVPGFEP RF RNPRRPG GTHPDLEHFG +DFI Sbjct: 264 ARFDPYGPPGVPGFEPNRFARNPRRPGSGTHPDLEHFGGGSDFI 307 >ref|XP_009378874.1| PREDICTED: probable proteasome inhibitor [Pyrus x bretschneideri] Length = 307 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/45 (88%), Positives = 41/45 (91%), Gaps = 1/45 (2%) Frame = -3 Query: 364 ARFDPYGPPGVPGFEPGRFVRNPRR-PGGGTHPDLEHFGSDTDFI 233 ARFDPYGPPGVPGFEP RF RNPRR PGGGTHPDLEHFGS +DFI Sbjct: 263 ARFDPYGPPGVPGFEPNRFARNPRRPPGGGTHPDLEHFGSGSDFI 307 >ref|XP_009378857.1| PREDICTED: probable proteasome inhibitor [Pyrus x bretschneideri] Length = 307 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/45 (88%), Positives = 41/45 (91%), Gaps = 1/45 (2%) Frame = -3 Query: 364 ARFDPYGPPGVPGFEPGRFVRNPRR-PGGGTHPDLEHFGSDTDFI 233 ARFDPYGPPGVPGFEP RF RNPRR PGGGTHPDLEHFGS +DFI Sbjct: 263 ARFDPYGPPGVPGFEPNRFARNPRRPPGGGTHPDLEHFGSGSDFI 307 >emb|CDP06558.1| unnamed protein product [Coffea canephora] Length = 310 Score = 90.5 bits (223), Expect = 4e-16 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = -3 Query: 364 ARFDPYGPPGVPGFEPGRFVRNPRRPGGGTHPDLEHFGSDTDFI 233 ARFDPYGPPGVPGFEP RF+R+PRRPGGGTHPDLEHFG +D I Sbjct: 267 ARFDPYGPPGVPGFEPNRFIRHPRRPGGGTHPDLEHFGDGSDII 310 >ref|XP_012087979.1| PREDICTED: probable proteasome inhibitor [Jatropha curcas] gi|643710328|gb|KDP24535.1| hypothetical protein JCGZ_25099 [Jatropha curcas] Length = 301 Score = 90.1 bits (222), Expect = 5e-16 Identities = 38/44 (86%), Positives = 39/44 (88%) Frame = -3 Query: 364 ARFDPYGPPGVPGFEPGRFVRNPRRPGGGTHPDLEHFGSDTDFI 233 ARFDPYGPPGVPGFEP RFVRNPRRPG G HPDLEHFG D+ FI Sbjct: 258 ARFDPYGPPGVPGFEPNRFVRNPRRPGRGNHPDLEHFGGDSGFI 301 >ref|XP_009358792.1| PREDICTED: probable proteasome inhibitor [Pyrus x bretschneideri] Length = 306 Score = 89.7 bits (221), Expect = 7e-16 Identities = 38/44 (86%), Positives = 39/44 (88%) Frame = -3 Query: 364 ARFDPYGPPGVPGFEPGRFVRNPRRPGGGTHPDLEHFGSDTDFI 233 ARFDPYGPPGVPGFEP RF RNPRR GGGTHPDLEHFG +DFI Sbjct: 263 ARFDPYGPPGVPGFEPNRFARNPRRRGGGTHPDLEHFGRGSDFI 306 >ref|XP_007026871.1| Proteasome inhibitor-related [Theobroma cacao] gi|508715476|gb|EOY07373.1| Proteasome inhibitor-related [Theobroma cacao] Length = 481 Score = 89.0 bits (219), Expect = 1e-15 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -3 Query: 364 ARFDPYGPPGVPGFEPGRFVRNPRRPGGGTHPDLEHFG 251 ARFDPYGPPGVPGFEP RFVRNPRRPGGGTHPDLEHFG Sbjct: 260 ARFDPYGPPGVPGFEPNRFVRNPRRPGGGTHPDLEHFG 297 >ref|XP_007205609.1| hypothetical protein PRUPE_ppa009070mg [Prunus persica] gi|462401251|gb|EMJ06808.1| hypothetical protein PRUPE_ppa009070mg [Prunus persica] Length = 307 Score = 88.2 bits (217), Expect = 2e-15 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = -3 Query: 364 ARFDPYGPPGVPGFEPGRFVRNPRRPGGGTHPDLEHFGSDTDFI 233 ARFDPYGPPGVPGFEP RF RNPRRPG GTHPDLE FG +DFI Sbjct: 264 ARFDPYGPPGVPGFEPNRFARNPRRPGSGTHPDLEQFGGGSDFI 307 >ref|XP_002275006.1| PREDICTED: probable proteasome inhibitor [Vitis vinifera] gi|297740291|emb|CBI30473.3| unnamed protein product [Vitis vinifera] Length = 296 Score = 88.2 bits (217), Expect = 2e-15 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -3 Query: 364 ARFDPYGPPGVPGFEPGRFVRNPRRPGGGTHPDLEHFGSDTDF 236 ARFDPYGPPGVPGFEP RF R PRRPGGGTHPDL+HFG+ +DF Sbjct: 254 ARFDPYGPPGVPGFEPNRFTRMPRRPGGGTHPDLQHFGTGSDF 296 >ref|XP_012832066.1| PREDICTED: probable proteasome inhibitor [Erythranthe guttatus] gi|604342768|gb|EYU41792.1| hypothetical protein MIMGU_mgv1a010833mg [Erythranthe guttata] Length = 300 Score = 87.8 bits (216), Expect = 3e-15 Identities = 39/45 (86%), Positives = 39/45 (86%), Gaps = 1/45 (2%) Frame = -3 Query: 364 ARFDPYGPPGVPGFEPGRFVRNPRRPG-GGTHPDLEHFGSDTDFI 233 ARFDPYGPPGVPGFEPGRFVRNPRRPG GG HPDL HF D DFI Sbjct: 256 ARFDPYGPPGVPGFEPGRFVRNPRRPGQGGPHPDLHHFHGDADFI 300 >ref|XP_010325823.1| PREDICTED: probable proteasome inhibitor isoform X1 [Solanum lycopersicum] Length = 305 Score = 87.4 bits (215), Expect = 3e-15 Identities = 38/46 (82%), Positives = 40/46 (86%), Gaps = 2/46 (4%) Frame = -3 Query: 364 ARFDPYGPPGVPGFEPGRFVRNPRRPGGG--THPDLEHFGSDTDFI 233 ARFDPYGPP VPGFEPGRF+RNPRRPGGG HPDL HFG D+DFI Sbjct: 260 ARFDPYGPPDVPGFEPGRFIRNPRRPGGGGKPHPDLPHFGGDSDFI 305 >ref|XP_006340975.1| PREDICTED: probable proteasome inhibitor-like isoform X2 [Solanum tuberosum] Length = 304 Score = 87.4 bits (215), Expect = 3e-15 Identities = 38/46 (82%), Positives = 40/46 (86%), Gaps = 2/46 (4%) Frame = -3 Query: 364 ARFDPYGPPGVPGFEPGRFVRNPRRPGGG--THPDLEHFGSDTDFI 233 ARFDPYGPP VPGFEPGRF+RNPRRPGGG HPDL HFG D+DFI Sbjct: 259 ARFDPYGPPDVPGFEPGRFIRNPRRPGGGGRPHPDLPHFGGDSDFI 304 >ref|XP_006340974.1| PREDICTED: probable proteasome inhibitor-like isoform X1 [Solanum tuberosum] Length = 305 Score = 87.4 bits (215), Expect = 3e-15 Identities = 38/46 (82%), Positives = 40/46 (86%), Gaps = 2/46 (4%) Frame = -3 Query: 364 ARFDPYGPPGVPGFEPGRFVRNPRRPGGG--THPDLEHFGSDTDFI 233 ARFDPYGPP VPGFEPGRF+RNPRRPGGG HPDL HFG D+DFI Sbjct: 260 ARFDPYGPPDVPGFEPGRFIRNPRRPGGGGRPHPDLPHFGGDSDFI 305 >ref|XP_004246392.1| PREDICTED: probable proteasome inhibitor isoform X2 [Solanum lycopersicum] Length = 304 Score = 87.4 bits (215), Expect = 3e-15 Identities = 38/46 (82%), Positives = 40/46 (86%), Gaps = 2/46 (4%) Frame = -3 Query: 364 ARFDPYGPPGVPGFEPGRFVRNPRRPGGG--THPDLEHFGSDTDFI 233 ARFDPYGPP VPGFEPGRF+RNPRRPGGG HPDL HFG D+DFI Sbjct: 259 ARFDPYGPPDVPGFEPGRFIRNPRRPGGGGKPHPDLPHFGGDSDFI 304