BLASTX nr result
ID: Forsythia21_contig00005686
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00005686 (642 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095140.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_012831793.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-08 gb|EYU42022.1| hypothetical protein MIMGU_mgv1a018881mg, partial... 67 1e-08 >ref|XP_011095140.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62680, mitochondrial-like [Sesamum indicum] Length = 488 Score = 68.2 bits (165), Expect = 3e-09 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = +3 Query: 504 LENPQQINHLLMALVTANEFELASKLKSNLSSFGLAPDSWTYSILV 641 L + NHLLM+LV A+EFELA KLKS+LSSFGL PDSWTYSIL+ Sbjct: 78 LHTISEFNHLLMSLVAADEFELAFKLKSSLSSFGLIPDSWTYSILL 123 >ref|XP_012831793.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62680, mitochondrial-like [Erythranthe guttatus] Length = 408 Score = 66.6 bits (161), Expect = 1e-08 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +3 Query: 519 QINHLLMALVTANEFELASKLKSNLSSFGLAPDSWTYSILV 641 + NHLLM+LV+A+EFELAS LKSNLSSFGL P+ WTYSI V Sbjct: 10 EFNHLLMSLVSADEFELASNLKSNLSSFGLIPNDWTYSIFV 50 >gb|EYU42022.1| hypothetical protein MIMGU_mgv1a018881mg, partial [Erythranthe guttata] Length = 441 Score = 66.6 bits (161), Expect = 1e-08 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +3 Query: 519 QINHLLMALVTANEFELASKLKSNLSSFGLAPDSWTYSILV 641 + NHLLM+LV+A+EFELAS LKSNLSSFGL P+ WTYSI V Sbjct: 43 EFNHLLMSLVSADEFELASNLKSNLSSFGLIPNDWTYSIFV 83