BLASTX nr result
ID: Forsythia21_contig00005035
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00005035 (369 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007674477.1| hypothetical protein BAUCODRAFT_32413 [Baudo... 69 2e-09 >ref|XP_007674477.1| hypothetical protein BAUCODRAFT_32413 [Baudoinia compniacensis UAMH 10762] gi|449302372|gb|EMC98381.1| hypothetical protein BAUCODRAFT_32413 [Baudoinia compniacensis UAMH 10762] Length = 78 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/52 (63%), Positives = 40/52 (76%) Frame = -2 Query: 245 METIKSVLGLGTTAPQEGREPVNGVTGSGVAGEPYDQGNAEDTTLGGKAPQH 90 M T+KS++GLG QEG+EPV+GV G G A EPYD GN+E+ LGGKAPQH Sbjct: 1 MNTLKSIVGLGKKE-QEGQEPVSGVQGEGNAVEPYDAGNSEEPELGGKAPQH 51