BLASTX nr result
ID: Forsythia21_contig00004938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00004938 (265 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011092466.1| PREDICTED: squalene monooxygenase-like [Sesa... 57 6e-06 >ref|XP_011092466.1| PREDICTED: squalene monooxygenase-like [Sesamum indicum] Length = 527 Score = 56.6 bits (135), Expect = 6e-06 Identities = 33/51 (64%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = -1 Query: 166 MVMINQYILGCFLASLFGFVLLDNLIGKLKK-NKGSKIMRKDQCIKTSDDG 17 MVMI+QYILG F+ASL FVLL NL K +K NK SK+ R D+CIKTS G Sbjct: 1 MVMIDQYILGGFVASLVAFVLLYNLPRKTRKTNKVSKVGRGDECIKTSAVG 51