BLASTX nr result
ID: Forsythia21_contig00003930
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00003930 (440 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AES99104.2| hypothetical protein MTR_5g076600 [Medicago trunc... 104 2e-20 ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago ... 104 2e-20 gb|KDP35707.1| hypothetical protein JCGZ_10479 [Jatropha curcas] 96 7e-18 ref|XP_007141973.1| hypothetical protein PHAVU_008G241600g [Phas... 96 1e-17 gb|EPS67586.1| hypothetical protein M569_07192, partial [Genlise... 92 1e-16 tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea m... 88 2e-15 gb|EMT14912.1| hypothetical protein F775_27789 [Aegilops tauschii] 78 2e-12 dbj|BAK05462.1| predicted protein [Hordeum vulgare subsp. vulgare] 76 8e-12 ref|XP_010227917.1| PREDICTED: uncharacterized protein LOC100843... 75 2e-11 >gb|AES99104.2| hypothetical protein MTR_5g076600 [Medicago truncatula] Length = 60 Score = 104 bits (260), Expect = 2e-20 Identities = 49/60 (81%), Positives = 57/60 (95%) Frame = -2 Query: 373 MKIFGKNIHPRQIILFASGVLFLASTTYDVHRSIKNNETPPTEEQIQALEDYIRSVRRPP 194 M+IFGK + PRQIILFASG+LFLASTTYDVHRSIKNNETPP+EEQ++ALE+YI+SVRR P Sbjct: 1 MRIFGKPVFPRQIILFASGLLFLASTTYDVHRSIKNNETPPSEEQLKALEEYIKSVRRSP 60 >ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago truncatula] Length = 119 Score = 104 bits (260), Expect = 2e-20 Identities = 49/60 (81%), Positives = 57/60 (95%) Frame = -2 Query: 373 MKIFGKNIHPRQIILFASGVLFLASTTYDVHRSIKNNETPPTEEQIQALEDYIRSVRRPP 194 M+IFGK + PRQIILFASG+LFLASTTYDVHRSIKNNETPP+EEQ++ALE+YI+SVRR P Sbjct: 1 MRIFGKPVFPRQIILFASGLLFLASTTYDVHRSIKNNETPPSEEQLKALEEYIKSVRRQP 60 >gb|KDP35707.1| hypothetical protein JCGZ_10479 [Jatropha curcas] Length = 60 Score = 96.3 bits (238), Expect = 7e-18 Identities = 46/60 (76%), Positives = 53/60 (88%) Frame = -2 Query: 373 MKIFGKNIHPRQIILFASGVLFLASTTYDVHRSIKNNETPPTEEQIQALEDYIRSVRRPP 194 MKIFGK + P QI+L ASGV+FLASTTYDVHRSIKNNETPP++EQ++ALEDYIRS R P Sbjct: 1 MKIFGKYVSPGQIMLMASGVVFLASTTYDVHRSIKNNETPPSKEQMEALEDYIRSKRASP 60 >ref|XP_007141973.1| hypothetical protein PHAVU_008G241600g [Phaseolus vulgaris] gi|561015106|gb|ESW13967.1| hypothetical protein PHAVU_008G241600g [Phaseolus vulgaris] Length = 60 Score = 95.5 bits (236), Expect = 1e-17 Identities = 43/58 (74%), Positives = 53/58 (91%) Frame = -2 Query: 373 MKIFGKNIHPRQIILFASGVLFLASTTYDVHRSIKNNETPPTEEQIQALEDYIRSVRR 200 M+IFGK++ P QIILFASG+LF ASTTYDVHRSIKNN+TPP++EQ++AL+DYI S RR Sbjct: 1 MRIFGKHVFPSQIILFASGLLFFASTTYDVHRSIKNNQTPPSQEQLKALQDYIESARR 58 >gb|EPS67586.1| hypothetical protein M569_07192, partial [Genlisea aurea] Length = 58 Score = 92.4 bits (228), Expect = 1e-16 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = -2 Query: 373 MKIFGKNIHPRQIILFASGVLFLASTTYDVHRSIKNNETPPTEEQIQALEDYIRSVRR 200 MKIFGK I RQI +F++GVLF A+TTYDVHRSIKNNE PP+ EQIQALEDYI SVRR Sbjct: 1 MKIFGKQISGRQIAVFSAGVLFFAATTYDVHRSIKNNEAPPSPEQIQALEDYIDSVRR 58 >tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea mays] Length = 750 Score = 88.2 bits (217), Expect = 2e-15 Identities = 40/62 (64%), Positives = 52/62 (83%), Gaps = 2/62 (3%) Frame = -2 Query: 373 MKIFGKNIHPRQIILFASGVLFLASTTYDVHRSIKNNETPPTEEQIQALEDYIRS--VRR 200 M++FGK++ PRQI+LFA+G++F +TTYDVHRSIKNNE PPT EQ++AL+DYI S R Sbjct: 687 MRLFGKHVFPRQIVLFAAGMVFFGATTYDVHRSIKNNEQPPTREQMEALQDYINSKNPRG 746 Query: 199 PP 194 PP Sbjct: 747 PP 748 >gb|EMT14912.1| hypothetical protein F775_27789 [Aegilops tauschii] Length = 58 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/58 (56%), Positives = 47/58 (81%) Frame = -2 Query: 373 MKIFGKNIHPRQIILFASGVLFLASTTYDVHRSIKNNETPPTEEQIQALEDYIRSVRR 200 M++ G+++ PRQI L A+G++F +TTYDVHRSIKNN+ PPT EQ+ AL+D+I S +R Sbjct: 1 MRVLGRHVSPRQIALLAAGLVFFGATTYDVHRSIKNNDQPPTREQVAALQDFIDSRKR 58 >dbj|BAK05462.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 58 Score = 76.3 bits (186), Expect = 8e-12 Identities = 32/58 (55%), Positives = 47/58 (81%) Frame = -2 Query: 373 MKIFGKNIHPRQIILFASGVLFLASTTYDVHRSIKNNETPPTEEQIQALEDYIRSVRR 200 M++ G+++ PRQI+L A+G++F +TTYDVHRSIKNN+ PPT EQ+ AL+ +I S +R Sbjct: 1 MRLLGRHVSPRQIVLLAAGLVFFGATTYDVHRSIKNNDQPPTSEQVAALQAFIDSRKR 58 >ref|XP_010227917.1| PREDICTED: uncharacterized protein LOC100843543 [Brachypodium distachyon] Length = 119 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/59 (59%), Positives = 47/59 (79%), Gaps = 2/59 (3%) Frame = -2 Query: 373 MKIFGKNIHPRQIILFASGVLFLASTTYDVHRSIKNNETPPTEEQIQALEDYI--RSVR 203 M+ GK++ PRQ+ LFA+G++F +TTYDVHRSIKNN+ PPT EQ++AL+ Y RSVR Sbjct: 1 MRPLGKHVSPRQVALFAAGLVFFGATTYDVHRSIKNNDQPPTREQMEALQVYTTPRSVR 59