BLASTX nr result
ID: Forsythia21_contig00003617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00003617 (404 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_045734788.1| hypothetical protein, partial [Pseudomonas p... 84 4e-14 ref|XP_012084959.1| PREDICTED: metallothionein-like protein type... 83 6e-14 gb|KCW67342.1| hypothetical protein EUGRSUZ_F01127 [Eucalyptus g... 81 3e-13 emb|CAB85630.1| putative metallothionein-like protein [Vitis vin... 80 7e-13 ref|XP_002525821.1| conserved hypothetical protein [Ricinus comm... 76 8e-12 gb|ABA43635.1| metallothionein-like protein [Metroxylon sagu] 76 8e-12 sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein... 74 4e-11 gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] 73 6e-11 ref|XP_002531714.1| conserved hypothetical protein [Ricinus comm... 73 8e-11 gb|AAF68995.1| metallothionein [Oryza coarctata] gi|157497143|gb... 72 1e-10 sp|P43389.1|MT3_ACTDE RecName: Full=Metallothionein-like protein... 72 1e-10 emb|CAB52585.1| metallothionein-like protein [Elaeis guineensis] 72 1e-10 sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein... 72 2e-10 gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] 72 2e-10 ref|XP_009757034.1| PREDICTED: metallothionein-like protein type... 71 2e-10 ref|XP_003628521.1| Metallothionein-like protein [Medicago trunc... 70 4e-10 ref|WP_048460945.1| hypothetical protein, partial [Streptomyces ... 70 5e-10 ref|XP_009356815.1| PREDICTED: metallothionein-like protein type... 70 5e-10 gb|AFP54303.1| metallothionein-like protein [Pyrus x bretschneid... 70 5e-10 gb|ACB10219.2| metallothionein-like protein [Elaeis guineensis] 69 9e-10 >ref|WP_045734788.1| hypothetical protein, partial [Pseudomonas pseudoalcaligenes] gi|782990300|gb|KJU81265.1| hypothetical protein N619_00020, partial [Pseudomonas pseudoalcaligenes] Length = 87 Score = 84.0 bits (206), Expect = 4e-14 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -3 Query: 369 MSGKCGNCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAA 235 MS CGNCDC D+SQCVKKG++YGIDIVET KSY+ETIVMDAPAA Sbjct: 22 MSSTCGNCDCADKSQCVKKGSSYGIDIVETGKSYVETIVMDAPAA 66 >ref|XP_012084959.1| PREDICTED: metallothionein-like protein type 3 [Jatropha curcas] gi|282848222|gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] gi|643714554|gb|KDP27057.1| hypothetical protein JCGZ_20992 [Jatropha curcas] Length = 67 Score = 83.2 bits (204), Expect = 6e-14 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -3 Query: 369 MSGKCGNCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 223 MS CGNCDC D+SQCVKKG++Y DIVETEKS++ TIVMD PA AEND Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVPAGAEND 49 >gb|KCW67342.1| hypothetical protein EUGRSUZ_F01127 [Eucalyptus grandis] Length = 69 Score = 80.9 bits (198), Expect = 3e-13 Identities = 37/49 (75%), Positives = 41/49 (83%) Frame = -3 Query: 369 MSGKCGNCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 223 MS KCGNCDC DQSQC KKG++Y D VETEKS+IET+ MDAP AAEND Sbjct: 1 MSDKCGNCDCADQSQCTKKGSSYAADFVETEKSHIETVFMDAP-AAEND 48 >emb|CAB85630.1| putative metallothionein-like protein [Vitis vinifera] gi|302143009|emb|CBI20304.3| unnamed protein product [Vitis vinifera] Length = 65 Score = 79.7 bits (195), Expect = 7e-13 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -3 Query: 357 CGNCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAA 235 CGNCDC D+SQCVKKGN+YGIDIVETEKSY+ T+VM+ PAA Sbjct: 4 CGNCDCADKSQCVKKGNSYGIDIVETEKSYVATVVMEVPAA 44 >ref|XP_002525821.1| conserved hypothetical protein [Ricinus communis] gi|223534826|gb|EEF36515.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 76.3 bits (186), Expect = 8e-12 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = -3 Query: 369 MSGKCGNCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAA 235 MS CGNCDC D+SQCVKKG++Y DIVETEKS++ TI+MD PAA Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIIMDVPAA 45 >gb|ABA43635.1| metallothionein-like protein [Metroxylon sagu] Length = 65 Score = 76.3 bits (186), Expect = 8e-12 Identities = 32/45 (71%), Positives = 42/45 (93%) Frame = -3 Query: 357 CGNCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 223 CGNCDC D+SQCVKKGN+YGI+I+ETEKSY++ +V +APAAA+N+ Sbjct: 4 CGNCDCADKSQCVKKGNSYGIEIIETEKSYVDHVV-EAPAAAKNE 47 >sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein type 3; Short=MT-3; AltName: Full=MWMT3 gi|12006150|gb|AAG44759.1|AF268393_1 metallothionein-like protein [Musa acuminata] gi|33337795|gb|AAQ13534.1|AF113750_1 metallothionein-like protein [Musa acuminata AAA Group] gi|1213512|gb|AAB82615.1| metallothionein-like protein [Musa acuminata AAA Group] Length = 65 Score = 73.9 bits (180), Expect = 4e-11 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = -3 Query: 357 CGNCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 223 CGNCDC D+SQCVKKGN+YGIDIVETEKSY++ +++ A AAE+D Sbjct: 4 CGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIV-AAEAAEHD 47 >gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] Length = 66 Score = 73.2 bits (178), Expect = 6e-11 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -3 Query: 369 MSGKCGNCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPA 238 MS CGNCDC D+SQCVKKG++Y DIVETEKS++ T+VM+ PA Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTVVMEVPA 44 >ref|XP_002531714.1| conserved hypothetical protein [Ricinus communis] gi|223528657|gb|EEF30673.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 72.8 bits (177), Expect = 8e-11 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -3 Query: 369 MSGKCGNCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAA 235 MS CGNCDC D+SQCVKKG++Y D+VETEKS + TIVM+ PAA Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADVVETEKSSVSTIVMEVPAA 45 >gb|AAF68995.1| metallothionein [Oryza coarctata] gi|157497143|gb|ABV58318.1| metallothionein type 3 [Oryza coarctata] Length = 64 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = -3 Query: 369 MSGKCGNCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 223 MS KCGNCDC D+SQCVKKGN+YG+ +V+TEKS++E I A A AEND Sbjct: 1 MSDKCGNCDCADKSQCVKKGNSYGVVLVDTEKSHLEEI---AAAGAEND 46 >sp|P43389.1|MT3_ACTDE RecName: Full=Metallothionein-like protein type 3 [Actinidia deliciosa] gi|1086020|pir||S48037 metallothionein-like protein - kiwi fruit gi|450241|gb|AAA53072.1| metallothionein-like protein [Actinidia deliciosa] Length = 63 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -3 Query: 369 MSGKCGNCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAA 235 MS KCGNCDC D SQCVKKGN+ IDIVET+KSYIE +VM PAA Sbjct: 1 MSDKCGNCDCADSSQCVKKGNS--IDIVETDKSYIEDVVMGVPAA 43 >emb|CAB52585.1| metallothionein-like protein [Elaeis guineensis] Length = 65 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -3 Query: 357 CGNCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 223 CGNCDC D+SQCVKKGN+YGI+I+ETEKS ++ DAPAAAE++ Sbjct: 4 CGNCDCADKSQCVKKGNSYGIEIIETEKSNFNNVI-DAPAAAEHE 47 >sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein type 3; Short=MT-3 [Carica papaya] gi|1566700|emb|CAA69624.1| metallothionein-like protein [Carica papaya] gi|354464673|gb|AER26532.1| metallothionein-like protein [Carica papaya] Length = 65 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -3 Query: 369 MSGKCGNCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 223 MS CGNCDC D++QCVKKG++Y DI+ETEKS I T+VMDAP AAEND Sbjct: 1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKS-IMTVVMDAP-AAEND 47 >gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] Length = 65 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/49 (67%), Positives = 39/49 (79%) Frame = -3 Query: 369 MSGKCGNCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 223 MS CGNCDC D++QCVK GN YG+DIVETEK +ET+VM+ P A END Sbjct: 1 MSNTCGNCDCADKTQCVK-GNKYGVDIVETEKRMVETVVMEVP-AGEND 47 >ref|XP_009757034.1| PREDICTED: metallothionein-like protein type 3 [Nicotiana sylvestris] Length = 66 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = -3 Query: 369 MSGKCGNCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 223 MS KCGNCDC+ SQCVKK N Y ++IVETEKSY E+IVM+A AAE+D Sbjct: 1 MSDKCGNCDCSSASQCVKKENQYNLEIVETEKSYSESIVMNA-GAAEHD 48 >ref|XP_003628521.1| Metallothionein-like protein [Medicago truncatula] gi|355522543|gb|AET02997.1| metallothionein-like protein type 3 [Medicago truncatula] gi|388521467|gb|AFK48795.1| unknown [Medicago truncatula] Length = 63 Score = 70.5 bits (171), Expect = 4e-10 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = -3 Query: 369 MSGKCGNCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPA 238 MS CGNCDC D+SQC KGN YG+ IVET+KS++ET+VMDAPA Sbjct: 1 MSSSCGNCDCADKSQC-GKGNNYGMTIVETQKSFVETVVMDAPA 43 >ref|WP_048460945.1| hypothetical protein, partial [Streptomyces sp. HNS054] Length = 88 Score = 70.1 bits (170), Expect = 5e-10 Identities = 36/59 (61%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = -3 Query: 396 SASFGT-NSTMSGKCGNCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 223 S +F T ST CGNCDC D+SQCVKKGN YG+DIVETEKSY + AAEND Sbjct: 13 SLAFATFPSTAMSTCGNCDCADKSQCVKKGNGYGVDIVETEKSYYGD-AGEVVTAAEND 70 >ref|XP_009356815.1| PREDICTED: metallothionein-like protein type 3 [Pyrus x bretschneideri] Length = 91 Score = 70.1 bits (170), Expect = 5e-10 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = -3 Query: 369 MSGKCGNCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 223 MSGKC NCDC D SQC KKG +Y + IVETE ++T+V+DAP AAEND Sbjct: 26 MSGKCDNCDCADSSQCTKKGKSYDLVIVETENRSMDTVVVDAP-AAEND 73 >gb|AFP54303.1| metallothionein-like protein [Pyrus x bretschneideri] Length = 66 Score = 70.1 bits (170), Expect = 5e-10 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = -3 Query: 369 MSGKCGNCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 223 MSGKC NCDC D SQC KKG +Y + IVETE ++T+V+DAP AAEND Sbjct: 1 MSGKCDNCDCADSSQCTKKGKSYDLVIVETENRSMDTVVVDAP-AAEND 48 >gb|ACB10219.2| metallothionein-like protein [Elaeis guineensis] Length = 65 Score = 69.3 bits (168), Expect = 9e-10 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -3 Query: 357 CGNCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 223 CGNCDC D+SQCVKKGN+YGI+I+ETEKS ++ DA AAAE++ Sbjct: 4 CGNCDCADKSQCVKKGNSYGIEIIETEKSNFNNVI-DASAAAEHE 47