BLASTX nr result
ID: Forsythia21_contig00003585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00003585 (362 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP49340.1| thioredoxin h [Olea europaea] 123 4e-26 ref|XP_012842781.1| PREDICTED: thioredoxin H-type 1 [Erythranthe... 116 5e-24 gb|EYU32886.1| hypothetical protein MIMGU_mgv1a015367mg [Erythra... 116 5e-24 ref|XP_009761049.1| PREDICTED: thioredoxin H-type 1 [Nicotiana s... 115 1e-23 ref|XP_004499205.1| PREDICTED: thioredoxin H-type 1-like [Cicer ... 114 2e-23 ref|XP_011074624.1| PREDICTED: thioredoxin H-type 1-like [Sesamu... 113 4e-23 gb|ACV52592.1| thioredoxin H-type 1, partial [Nicotiana benthami... 113 6e-23 gb|ACI31202.1| TRX [Salvia miltiorrhiza] 112 7e-23 emb|CAH59450.1| thioredoxin 1 [Plantago major] 111 2e-22 ref|XP_009603030.1| PREDICTED: thioredoxin H-type 1 [Nicotiana t... 110 3e-22 ref|XP_006341987.1| PREDICTED: thioredoxin H-type 1-like [Solanu... 109 6e-22 gb|AAR83852.1| thioredoxin [Capsicum annuum] gi|125489263|gb|ABN... 109 8e-22 emb|CAC42084.1| thioredoxin h [Pisum sativum] 108 1e-21 gb|AFY26881.1| thioredoxin [Ipomoea batatas] 108 2e-21 gb|AFI74352.1| thioredoxin [Tamarix hispida] 107 4e-21 gb|AAQ23135.1| thioredoxin H3 [Ipomoea batatas] 107 4e-21 ref|XP_004238306.1| PREDICTED: thioredoxin H-type 1 [Solanum lyc... 106 5e-21 gb|AEC03317.1| thioredoxin H-type 3 [Hevea brasiliensis] 105 9e-21 gb|KEH36212.1| thioredoxin H-type 1 protein [Medicago truncatula] 105 2e-20 gb|AAZ32865.1| thioredoxin h [Medicago sativa] 105 2e-20 >gb|AFP49340.1| thioredoxin h [Olea europaea] Length = 123 Score = 123 bits (309), Expect = 4e-26 Identities = 61/69 (88%), Positives = 66/69 (95%) Frame = -3 Query: 360 PILAEIAKKTPHVIFLKVDVDELKEVAQEFNVEAMPTFVFLKEGKEVDRLVGAKKEDLQA 181 PILAEIAKKTPHVIFLKVDVDELK+VA+EFNVEAMPTFVFLK+GKEVDRLVGA+KE+LQ Sbjct: 48 PILAEIAKKTPHVIFLKVDVDELKDVAKEFNVEAMPTFVFLKDGKEVDRLVGARKENLQD 107 Query: 180 TITKHATVT 154 TI KHAT T Sbjct: 108 TINKHATAT 116 >ref|XP_012842781.1| PREDICTED: thioredoxin H-type 1 [Erythranthe guttatus] Length = 119 Score = 116 bits (291), Expect = 5e-24 Identities = 57/70 (81%), Positives = 64/70 (91%) Frame = -3 Query: 360 PILAEIAKKTPHVIFLKVDVDELKEVAQEFNVEAMPTFVFLKEGKEVDRLVGAKKEDLQA 181 PILAEIAKKTPH IFLKVDVDELK VA+E++VEAMPTF+F KEGKEVD++VGAKKEDL A Sbjct: 50 PILAEIAKKTPHAIFLKVDVDELKSVAEEYHVEAMPTFLFFKEGKEVDKVVGAKKEDLLA 109 Query: 180 TITKHATVTA 151 IT HAT+TA Sbjct: 110 KITAHATLTA 119 >gb|EYU32886.1| hypothetical protein MIMGU_mgv1a015367mg [Erythranthe guttata] Length = 160 Score = 116 bits (291), Expect = 5e-24 Identities = 57/70 (81%), Positives = 64/70 (91%) Frame = -3 Query: 360 PILAEIAKKTPHVIFLKVDVDELKEVAQEFNVEAMPTFVFLKEGKEVDRLVGAKKEDLQA 181 PILAEIAKKTPH IFLKVDVDELK VA+E++VEAMPTF+F KEGKEVD++VGAKKEDL A Sbjct: 91 PILAEIAKKTPHAIFLKVDVDELKSVAEEYHVEAMPTFLFFKEGKEVDKVVGAKKEDLLA 150 Query: 180 TITKHATVTA 151 IT HAT+TA Sbjct: 151 KITAHATLTA 160 >ref|XP_009761049.1| PREDICTED: thioredoxin H-type 1 [Nicotiana sylvestris] Length = 123 Score = 115 bits (287), Expect = 1e-23 Identities = 60/73 (82%), Positives = 66/73 (90%), Gaps = 3/73 (4%) Frame = -3 Query: 360 PILAEIAKKTPHVIFLKVDVDELKEVAQEFNVEAMPTFVFLKEGKEVDRLVGAKKEDLQA 181 PILAEIAKK PHVIFLKVDVDELK VA+E++VEAMPTFVFLK+GKEVDR+VGAKKE+LQ Sbjct: 51 PILAEIAKKMPHVIFLKVDVDELKTVAEEWSVEAMPTFVFLKDGKEVDRVVGAKKEELQQ 110 Query: 180 TITKH---ATVTA 151 TI KH ATVTA Sbjct: 111 TIVKHAAPATVTA 123 >ref|XP_004499205.1| PREDICTED: thioredoxin H-type 1-like [Cicer arietinum] Length = 120 Score = 114 bits (286), Expect = 2e-23 Identities = 57/69 (82%), Positives = 64/69 (92%) Frame = -3 Query: 360 PILAEIAKKTPHVIFLKVDVDELKEVAQEFNVEAMPTFVFLKEGKEVDRLVGAKKEDLQA 181 PILAEIAK TPHVIFLKVDVDELK VA+E++VEAMPTF+FLKEGK+VD++VGAKKE LQ Sbjct: 48 PILAEIAKNTPHVIFLKVDVDELKTVAEEWSVEAMPTFLFLKEGKKVDKVVGAKKELLQQ 107 Query: 180 TITKHATVT 154 TITKHAT T Sbjct: 108 TITKHATAT 116 >ref|XP_011074624.1| PREDICTED: thioredoxin H-type 1-like [Sesamum indicum] Length = 120 Score = 113 bits (283), Expect = 4e-23 Identities = 57/65 (87%), Positives = 61/65 (93%) Frame = -3 Query: 360 PILAEIAKKTPHVIFLKVDVDELKEVAQEFNVEAMPTFVFLKEGKEVDRLVGAKKEDLQA 181 PILAEIAKKT HVIFLKVDVDELK VAQ++NVEAMPTF+FLK G+EVDRLVGAKKEDLQA Sbjct: 49 PILAEIAKKTTHVIFLKVDVDELKTVAQKYNVEAMPTFLFLKGGEEVDRLVGAKKEDLQA 108 Query: 180 TITKH 166 ITKH Sbjct: 109 LITKH 113 >gb|ACV52592.1| thioredoxin H-type 1, partial [Nicotiana benthamiana] Length = 119 Score = 113 bits (282), Expect = 6e-23 Identities = 58/73 (79%), Positives = 66/73 (90%), Gaps = 3/73 (4%) Frame = -3 Query: 360 PILAEIAKKTPHVIFLKVDVDELKEVAQEFNVEAMPTFVFLKEGKEVDRLVGAKKEDLQA 181 P+LA+IAKK PHVIFLKVDVDELK VA+E++VEAMPTFVFLK+GKEVDR+VGAKKE+LQ Sbjct: 47 PVLADIAKKMPHVIFLKVDVDELKTVAEEWSVEAMPTFVFLKDGKEVDRVVGAKKEELQQ 106 Query: 180 TITKH---ATVTA 151 TI KH ATVTA Sbjct: 107 TILKHAAPATVTA 119 >gb|ACI31202.1| TRX [Salvia miltiorrhiza] Length = 122 Score = 112 bits (281), Expect = 7e-23 Identities = 55/72 (76%), Positives = 66/72 (91%), Gaps = 2/72 (2%) Frame = -3 Query: 360 PILAEIAKKTPHVIFLKVDVDELKEVAQEFNVEAMPTFVFLKEGKEVDRLVGAKKEDLQA 181 PILAEIAKKTPHVIFLKVDVDELK VAQE+N+EAMP+F+F+KEGKE+DR+VGA+KEDL A Sbjct: 49 PILAEIAKKTPHVIFLKVDVDELKTVAQEYNIEAMPSFLFIKEGKEIDRVVGARKEDLLA 108 Query: 180 TITKH--ATVTA 151 +T+H A +TA Sbjct: 109 KVTQHGGAALTA 120 >emb|CAH59450.1| thioredoxin 1 [Plantago major] Length = 119 Score = 111 bits (277), Expect = 2e-22 Identities = 54/70 (77%), Positives = 61/70 (87%) Frame = -3 Query: 360 PILAEIAKKTPHVIFLKVDVDELKEVAQEFNVEAMPTFVFLKEGKEVDRLVGAKKEDLQA 181 PILAE+AKKTPHV+FLKVDVDELK ++ E+ VEAMPTFVFLK+GK +DRLVGAKKEDL A Sbjct: 50 PILAELAKKTPHVMFLKVDVDELKAISVEYEVEAMPTFVFLKDGKPIDRLVGAKKEDLLA 109 Query: 180 TITKHATVTA 151 IT H TV A Sbjct: 110 KITTHGTVVA 119 >ref|XP_009603030.1| PREDICTED: thioredoxin H-type 1 [Nicotiana tomentosiformis] gi|267124|sp|P29449.1|TRXH1_TOBAC RecName: Full=Thioredoxin H-type 1; Short=Trx-H1 [Nicotiana tabacum] gi|20047|emb|CAA41415.1| thioredoxin [Nicotiana tabacum] Length = 126 Score = 110 bits (276), Expect = 3e-22 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 3/73 (4%) Frame = -3 Query: 360 PILAEIAKKTPHVIFLKVDVDELKEVAQEFNVEAMPTFVFLKEGKEVDRLVGAKKEDLQA 181 PILA+IAKK PHVIFLKVDVDELK V+ E++VEAMPTFVF+K+GKEVDR+VGAKKE+LQ Sbjct: 54 PILADIAKKMPHVIFLKVDVDELKTVSAEWSVEAMPTFVFIKDGKEVDRVVGAKKEELQQ 113 Query: 180 TITKH---ATVTA 151 TI KH ATVTA Sbjct: 114 TIVKHAAPATVTA 126 >ref|XP_006341987.1| PREDICTED: thioredoxin H-type 1-like [Solanum tuberosum] Length = 123 Score = 109 bits (273), Expect = 6e-22 Identities = 54/70 (77%), Positives = 61/70 (87%) Frame = -3 Query: 360 PILAEIAKKTPHVIFLKVDVDELKEVAQEFNVEAMPTFVFLKEGKEVDRLVGAKKEDLQA 181 PILAEIAKKTPHVIFLKVDVDELK+V++++NVEAMPTFVF+KEGKEVDR+VGA KE L Sbjct: 50 PILAEIAKKTPHVIFLKVDVDELKKVSEDWNVEAMPTFVFIKEGKEVDRVVGAHKEGLLQ 109 Query: 180 TITKHATVTA 151 TI KH A Sbjct: 110 TIEKHGAAPA 119 >gb|AAR83852.1| thioredoxin [Capsicum annuum] gi|125489263|gb|ABN42904.1| thioredoxin H-type [Capsicum annuum] Length = 124 Score = 109 bits (272), Expect = 8e-22 Identities = 56/74 (75%), Positives = 65/74 (87%), Gaps = 4/74 (5%) Frame = -3 Query: 360 PILAEIAKKTPHVIFLKVDVDELKEVAQEFNVEAMPTFVFLKEGKEVDRLVGAKKEDLQA 181 PILA+IAKK PHVIFLKVDVDELK VA+E+NV+AMPTFVF K+G+EVDR+VGA+KE+LQA Sbjct: 51 PILADIAKKMPHVIFLKVDVDELKTVAEEWNVDAMPTFVFFKDGEEVDRVVGAQKEELQA 110 Query: 180 TITKH----ATVTA 151 I KH ATVTA Sbjct: 111 AILKHVGAPATVTA 124 >emb|CAC42084.1| thioredoxin h [Pisum sativum] Length = 118 Score = 108 bits (270), Expect = 1e-21 Identities = 52/70 (74%), Positives = 62/70 (88%) Frame = -3 Query: 360 PILAEIAKKTPHVIFLKVDVDELKEVAQEFNVEAMPTFVFLKEGKEVDRLVGAKKEDLQA 181 PILAEIAKKTP VIFLKVD+DEL+ VA+E+++EAMPTF+ LKEG EVD++VGAKKE+LQ Sbjct: 47 PILAEIAKKTPQVIFLKVDIDELESVAEEWSIEAMPTFLLLKEGMEVDKVVGAKKEELQL 106 Query: 180 TITKHATVTA 151 ITKHAT A Sbjct: 107 AITKHATTVA 116 >gb|AFY26881.1| thioredoxin [Ipomoea batatas] Length = 122 Score = 108 bits (269), Expect = 2e-21 Identities = 54/68 (79%), Positives = 60/68 (88%) Frame = -3 Query: 360 PILAEIAKKTPHVIFLKVDVDELKEVAQEFNVEAMPTFVFLKEGKEVDRLVGAKKEDLQA 181 PILAEIAKK HVIF+KVDVDEL+ VA E+ VEAMPTFVFLK+G EVDR+VGAKK+DLQ Sbjct: 52 PILAEIAKKMTHVIFVKVDVDELQAVAVEYKVEAMPTFVFLKDGNEVDRMVGAKKDDLQN 111 Query: 180 TITKHATV 157 ITKHATV Sbjct: 112 CITKHATV 119 >gb|AFI74352.1| thioredoxin [Tamarix hispida] Length = 139 Score = 107 bits (266), Expect = 4e-21 Identities = 52/70 (74%), Positives = 62/70 (88%) Frame = -3 Query: 360 PILAEIAKKTPHVIFLKVDVDELKEVAQEFNVEAMPTFVFLKEGKEVDRLVGAKKEDLQA 181 PIL ++AKK PHVIFLKVDVDEL+ VAQE+ V AM TFVFLKEGKE++R+VGA+KE+LQA Sbjct: 48 PILQDLAKKFPHVIFLKVDVDELQPVAQEWRVGAMSTFVFLKEGKELERVVGARKEELQA 107 Query: 180 TITKHATVTA 151 T+ KHAT TA Sbjct: 108 TVAKHATATA 117 >gb|AAQ23135.1| thioredoxin H3 [Ipomoea batatas] Length = 123 Score = 107 bits (266), Expect = 4e-21 Identities = 53/66 (80%), Positives = 59/66 (89%) Frame = -3 Query: 360 PILAEIAKKTPHVIFLKVDVDELKEVAQEFNVEAMPTFVFLKEGKEVDRLVGAKKEDLQA 181 PILAEIAKK HVIF+KVDVDEL+ VA E+ VEAMPTFVFLK+GKEVDR+VGAKK+DLQ Sbjct: 52 PILAEIAKKMAHVIFVKVDVDELQAVAAEYKVEAMPTFVFLKDGKEVDRMVGAKKDDLQN 111 Query: 180 TITKHA 163 ITKHA Sbjct: 112 CITKHA 117 >ref|XP_004238306.1| PREDICTED: thioredoxin H-type 1 [Solanum lycopersicum] Length = 123 Score = 106 bits (265), Expect = 5e-21 Identities = 52/70 (74%), Positives = 60/70 (85%) Frame = -3 Query: 360 PILAEIAKKTPHVIFLKVDVDELKEVAQEFNVEAMPTFVFLKEGKEVDRLVGAKKEDLQA 181 PILA+IAKK PHV+FLKVDVDELK+VA+E+NVEAMPTFVF+KEGKEVDR+VGA K+ L Sbjct: 50 PILADIAKKMPHVMFLKVDVDELKKVAEEWNVEAMPTFVFIKEGKEVDRVVGANKDGLLQ 109 Query: 180 TITKHATVTA 151 TI KH A Sbjct: 110 TIEKHGAAPA 119 >gb|AEC03317.1| thioredoxin H-type 3 [Hevea brasiliensis] Length = 118 Score = 105 bits (263), Expect = 9e-21 Identities = 52/70 (74%), Positives = 60/70 (85%) Frame = -3 Query: 360 PILAEIAKKTPHVIFLKVDVDELKEVAQEFNVEAMPTFVFLKEGKEVDRLVGAKKEDLQA 181 PILAE AKK PHV FLKVDVDELK VA+++ VEAMPTF+FLKEGK +D++VGAKKE+LQ Sbjct: 47 PILAEFAKKMPHVTFLKVDVDELKTVAEDWAVEAMPTFMFLKEGKIIDKVVGAKKEELQQ 106 Query: 180 TITKHATVTA 151 TI KHAT A Sbjct: 107 TIAKHATEVA 116 >gb|KEH36212.1| thioredoxin H-type 1 protein [Medicago truncatula] Length = 117 Score = 105 bits (261), Expect = 2e-20 Identities = 53/70 (75%), Positives = 61/70 (87%) Frame = -3 Query: 360 PILAEIAKKTPHVIFLKVDVDELKEVAQEFNVEAMPTFVFLKEGKEVDRLVGAKKEDLQA 181 PILAEIAKK P+V FLKVDVDELK VA+E+ V+AMPTF+FLKEGK VD++VGA+KE LQA Sbjct: 48 PILAEIAKKLPNVTFLKVDVDELKTVAEEWAVDAMPTFLFLKEGKLVDKVVGAQKEQLQA 107 Query: 180 TITKHATVTA 151 ITKHAT A Sbjct: 108 AITKHATTDA 117 >gb|AAZ32865.1| thioredoxin h [Medicago sativa] Length = 117 Score = 105 bits (261), Expect = 2e-20 Identities = 53/70 (75%), Positives = 61/70 (87%) Frame = -3 Query: 360 PILAEIAKKTPHVIFLKVDVDELKEVAQEFNVEAMPTFVFLKEGKEVDRLVGAKKEDLQA 181 PILAEIAKK P+V FLKVDVDELK VA+E+ V+AMPTF+FLKEGK VD++VGA+KE LQA Sbjct: 48 PILAEIAKKLPNVTFLKVDVDELKTVAEEWAVDAMPTFLFLKEGKLVDKVVGAQKEQLQA 107 Query: 180 TITKHATVTA 151 ITKHAT A Sbjct: 108 AITKHATTDA 117