BLASTX nr result
ID: Forsythia21_contig00003410
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00003410 (489 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012849412.1| PREDICTED: uncharacterized protein LOC105969... 59 1e-06 gb|EPS72364.1| hypothetical protein M569_02394, partial [Genlise... 57 4e-06 ref|XP_011095708.1| PREDICTED: uncharacterized protein LOC105175... 57 5e-06 ref|XP_011086360.1| PREDICTED: uncharacterized protein LOC105168... 56 8e-06 >ref|XP_012849412.1| PREDICTED: uncharacterized protein LOC105969207 [Erythranthe guttatus] gi|604314854|gb|EYU27560.1| hypothetical protein MIMGU_mgv1a012732mg [Erythranthe guttata] Length = 242 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -2 Query: 326 YVLISEGNPVCPRCNCSVPLSVAVKKPRIDLNIS 225 YVLIS+ NP CPRC+C VP VA KKPRIDLNIS Sbjct: 208 YVLISKSNPKCPRCSCVVPFPVAAKKPRIDLNIS 241 >gb|EPS72364.1| hypothetical protein M569_02394, partial [Genlisea aurea] Length = 233 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 326 YVLISEGNPVCPRCNCSVPLSVAVKKPRIDLNIS 225 YVLIS+ NP CPRCN VP+ +A KKPRIDLNIS Sbjct: 199 YVLISKNNPKCPRCNTRVPVPIAAKKPRIDLNIS 232 >ref|XP_011095708.1| PREDICTED: uncharacterized protein LOC105175084 [Sesamum indicum] Length = 236 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 326 YVLISEGNPVCPRCNCSVPLSVAVKKPRIDLNIS 225 YVLI++ NP CPRCN VPL +A KKPRIDLNIS Sbjct: 202 YVLITKSNPKCPRCNSDVPLPMAAKKPRIDLNIS 235 >ref|XP_011086360.1| PREDICTED: uncharacterized protein LOC105168112 [Sesamum indicum] Length = 235 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -2 Query: 326 YVLISEGNPVCPRCNCSVPLSVAVKKPRIDLNIS 225 YVLIS NP CPRC +VPL VA KKPRIDLNIS Sbjct: 201 YVLISRSNPKCPRCYSNVPLPVAAKKPRIDLNIS 234