BLASTX nr result
ID: Forsythia21_contig00003259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00003259 (419 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003665079.1| glycoside hydrolase family 28 protein [Mycel... 59 1e-06 >ref|XP_003665079.1| glycoside hydrolase family 28 protein [Myceliophthora thermophila ATCC 42464] gi|347012350|gb|AEO59834.1| glycoside hydrolase family 28 protein [Myceliophthora thermophila ATCC 42464] Length = 463 Score = 58.9 bits (141), Expect = 1e-06 Identities = 35/76 (46%), Positives = 43/76 (56%), Gaps = 11/76 (14%) Frame = -1 Query: 200 RGAMPPGAAIV---------PAIALEPRGSGKHD--HKDKWGCNKPEYRHTVTIRASKNE 54 R A+P GA+I P++ LE RG G+ KD WG + R VTIRASK++ Sbjct: 24 REAIPAGASITFPRHESQFNPSVTLEGRGHGRGHGREKDNWGNAVEKDRQKVTIRASKHD 83 Query: 53 TDDISADLLWAFHKAN 6 DDIS D LWA KAN Sbjct: 84 RDDISDDFLWALKKAN 99