BLASTX nr result
ID: Forsythia21_contig00003196
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00003196 (346 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516402.1| conserved hypothetical protein [Ricinus comm... 60 4e-07 >ref|XP_002516402.1| conserved hypothetical protein [Ricinus communis] gi|223544500|gb|EEF46019.1| conserved hypothetical protein [Ricinus communis] Length = 52 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +3 Query: 6 EVALTTEPCLSLGANWMIGPRAAPSSPHSPFPNM 107 EVAL TEPCL +GANWMIGPR S PHSPFPN+ Sbjct: 19 EVALPTEPCLPVGANWMIGPRTGLSFPHSPFPNI 52