BLASTX nr result
ID: Forsythia21_contig00001614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00001614 (461 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW77577.1| hypothetical protein EUGRSUZ_D01892 [Eucalyptus g... 130 3e-28 ref|XP_010024640.1| PREDICTED: thaumatin-like protein [Eucalyptu... 130 3e-28 gb|KCW61089.1| hypothetical protein EUGRSUZ_H03863 [Eucalyptus g... 130 3e-28 gb|KCW77588.1| hypothetical protein EUGRSUZ_D01904 [Eucalyptus g... 129 6e-28 ref|XP_007099628.1| Pathogenesis-related thaumatin-like protein,... 129 1e-27 gb|AJR20992.1| thaumatin-like protein/pathogenesis related prote... 128 1e-27 ref|XP_010024638.1| PREDICTED: thaumatin-like protein [Eucalyptu... 128 1e-27 ref|XP_008238907.1| PREDICTED: protein P21-like [Prunus mume] 128 2e-27 ref|XP_008238908.1| PREDICTED: protein P21-like [Prunus mume] 127 3e-27 ref|XP_008238906.1| PREDICTED: protein P21-like [Prunus mume] 127 3e-27 ref|XP_007210589.1| hypothetical protein PRUPE_ppa016268mg [Prun... 126 6e-27 ref|XP_010053306.1| PREDICTED: thaumatin-like protein [Eucalyptu... 125 8e-27 ref|XP_009345456.1| PREDICTED: thaumatin-like protein [Pyrus x b... 125 8e-27 gb|KCW77579.1| hypothetical protein EUGRSUZ_D01894 [Eucalyptus g... 125 8e-27 gb|ADP69173.1| pathogenesis related protein-5 [Populus tomentosa] 125 8e-27 emb|CAC22342.1| osmotin-like protein [Quercus robur] 125 1e-26 ref|XP_010054781.1| PREDICTED: thaumatin-like protein [Eucalyptu... 125 1e-26 gb|AAV34889.2| osmotin-like [Theobroma cacao] 125 1e-26 ref|XP_007040162.1| Osmotin 34 [Theobroma cacao] gi|508777407|gb... 125 1e-26 emb|CDP09784.1| unnamed protein product [Coffea canephora] 124 2e-26 >gb|KCW77577.1| hypothetical protein EUGRSUZ_D01892 [Eucalyptus grandis] Length = 225 Score = 130 bits (328), Expect = 3e-28 Identities = 55/59 (93%), Positives = 56/59 (94%) Frame = -2 Query: 460 PCTVFKTDQYCCNSGSCEPTSFSKFFKDRCPDAYSYPTDDQTSTFNCPGGTNYRVVFCP 284 PCTVFKTDQYCCNSGSC PT+FSKFFKDRCPDAYSYP DDQTSTF CPGGTNYRVVFCP Sbjct: 167 PCTVFKTDQYCCNSGSCGPTNFSKFFKDRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 225 >ref|XP_010024640.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis] gi|629095096|gb|KCW61091.1| hypothetical protein EUGRSUZ_H03865 [Eucalyptus grandis] Length = 225 Score = 130 bits (328), Expect = 3e-28 Identities = 55/59 (93%), Positives = 56/59 (94%) Frame = -2 Query: 460 PCTVFKTDQYCCNSGSCEPTSFSKFFKDRCPDAYSYPTDDQTSTFNCPGGTNYRVVFCP 284 PCTVFKTDQYCCNSGSC PT+FSKFFKDRCPDAYSYP DDQTSTF CPGGTNYRVVFCP Sbjct: 167 PCTVFKTDQYCCNSGSCGPTNFSKFFKDRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 225 >gb|KCW61089.1| hypothetical protein EUGRSUZ_H03863 [Eucalyptus grandis] Length = 212 Score = 130 bits (328), Expect = 3e-28 Identities = 55/59 (93%), Positives = 56/59 (94%) Frame = -2 Query: 460 PCTVFKTDQYCCNSGSCEPTSFSKFFKDRCPDAYSYPTDDQTSTFNCPGGTNYRVVFCP 284 PCTVFKTDQYCCNSGSC PT+FSKFFKDRCPDAYSYP DDQTSTF CPGGTNYRVVFCP Sbjct: 154 PCTVFKTDQYCCNSGSCGPTNFSKFFKDRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 212 >gb|KCW77588.1| hypothetical protein EUGRSUZ_D01904 [Eucalyptus grandis] Length = 225 Score = 129 bits (325), Expect = 6e-28 Identities = 54/59 (91%), Positives = 56/59 (94%) Frame = -2 Query: 460 PCTVFKTDQYCCNSGSCEPTSFSKFFKDRCPDAYSYPTDDQTSTFNCPGGTNYRVVFCP 284 PCTVFKTD+YCCNSGSC PT+FSKFFKDRCPDAYSYP DDQTSTF CPGGTNYRVVFCP Sbjct: 167 PCTVFKTDEYCCNSGSCGPTNFSKFFKDRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 225 >ref|XP_007099628.1| Pathogenesis-related thaumatin-like protein, putative [Theobroma cacao] gi|508728506|gb|EOY20403.1| Pathogenesis-related thaumatin-like protein, putative [Theobroma cacao] Length = 245 Score = 129 bits (323), Expect = 1e-27 Identities = 53/59 (89%), Positives = 55/59 (93%) Frame = -2 Query: 460 PCTVFKTDQYCCNSGSCEPTSFSKFFKDRCPDAYSYPTDDQTSTFNCPGGTNYRVVFCP 284 PCTVFKTDQYCCNSG+C PT +SKFFKDRCPDAYSYP DDQTSTF CPGGTNYRVVFCP Sbjct: 187 PCTVFKTDQYCCNSGNCSPTDYSKFFKDRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 245 >gb|AJR20992.1| thaumatin-like protein/pathogenesis related protein-5 [Populus szechuanica] Length = 225 Score = 128 bits (322), Expect = 1e-27 Identities = 53/59 (89%), Positives = 55/59 (93%) Frame = -2 Query: 460 PCTVFKTDQYCCNSGSCEPTSFSKFFKDRCPDAYSYPTDDQTSTFNCPGGTNYRVVFCP 284 PCTVFKTDQYCCNSGSCEPT +S+FFK RCPDAYSYP DDQTSTF CPGGTNYRVVFCP Sbjct: 167 PCTVFKTDQYCCNSGSCEPTDYSRFFKQRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 225 >ref|XP_010024638.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis] gi|702513212|ref|XP_010041217.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis] gi|629075933|gb|KCW44533.1| hypothetical protein EUGRSUZ_L01962 [Eucalyptus grandis] gi|629095095|gb|KCW61090.1| hypothetical protein EUGRSUZ_H03864 [Eucalyptus grandis] Length = 225 Score = 128 bits (322), Expect = 1e-27 Identities = 54/59 (91%), Positives = 55/59 (93%) Frame = -2 Query: 460 PCTVFKTDQYCCNSGSCEPTSFSKFFKDRCPDAYSYPTDDQTSTFNCPGGTNYRVVFCP 284 PCTVFKTDQYCCNSGSC PT+FSKFFKDRCPDAYSYP DDQTSTF CP GTNYRVVFCP Sbjct: 167 PCTVFKTDQYCCNSGSCGPTNFSKFFKDRCPDAYSYPKDDQTSTFTCPSGTNYRVVFCP 225 >ref|XP_008238907.1| PREDICTED: protein P21-like [Prunus mume] Length = 226 Score = 128 bits (321), Expect = 2e-27 Identities = 54/59 (91%), Positives = 54/59 (91%) Frame = -2 Query: 460 PCTVFKTDQYCCNSGSCEPTSFSKFFKDRCPDAYSYPTDDQTSTFNCPGGTNYRVVFCP 284 PCTVFKTDQYCCNSGSC PT FSKFFKDRCPDAYSYP DDQTSTF CP GTNYRVVFCP Sbjct: 168 PCTVFKTDQYCCNSGSCSPTDFSKFFKDRCPDAYSYPKDDQTSTFTCPTGTNYRVVFCP 226 >ref|XP_008238908.1| PREDICTED: protein P21-like [Prunus mume] Length = 225 Score = 127 bits (319), Expect = 3e-27 Identities = 52/59 (88%), Positives = 55/59 (93%) Frame = -2 Query: 460 PCTVFKTDQYCCNSGSCEPTSFSKFFKDRCPDAYSYPTDDQTSTFNCPGGTNYRVVFCP 284 PCTVFKTD+YCCNSGSC+PT FS+FFK RCPDAYSYP DDQTSTF CPGGTNYRVVFCP Sbjct: 167 PCTVFKTDEYCCNSGSCQPTDFSRFFKSRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 225 >ref|XP_008238906.1| PREDICTED: protein P21-like [Prunus mume] Length = 226 Score = 127 bits (319), Expect = 3e-27 Identities = 54/59 (91%), Positives = 54/59 (91%) Frame = -2 Query: 460 PCTVFKTDQYCCNSGSCEPTSFSKFFKDRCPDAYSYPTDDQTSTFNCPGGTNYRVVFCP 284 PCTVFKTDQYCCNSGSC PT FSKFFKDRCPDAYSYP DDQTSTF CP GTNYRVVFCP Sbjct: 168 PCTVFKTDQYCCNSGSCGPTDFSKFFKDRCPDAYSYPKDDQTSTFTCPTGTNYRVVFCP 226 >ref|XP_007210589.1| hypothetical protein PRUPE_ppa016268mg [Prunus persica] gi|462406324|gb|EMJ11788.1| hypothetical protein PRUPE_ppa016268mg [Prunus persica] Length = 226 Score = 126 bits (316), Expect = 6e-27 Identities = 53/59 (89%), Positives = 54/59 (91%) Frame = -2 Query: 460 PCTVFKTDQYCCNSGSCEPTSFSKFFKDRCPDAYSYPTDDQTSTFNCPGGTNYRVVFCP 284 PCTVFKTDQYCCNSGSC PT FS+FFKDRCPDAYSYP DDQTSTF CP GTNYRVVFCP Sbjct: 168 PCTVFKTDQYCCNSGSCGPTDFSRFFKDRCPDAYSYPKDDQTSTFTCPTGTNYRVVFCP 226 >ref|XP_010053306.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis] Length = 433 Score = 125 bits (315), Expect = 8e-27 Identities = 53/61 (86%), Positives = 55/61 (90%) Frame = -2 Query: 460 PCTVFKTDQYCCNSGSCEPTSFSKFFKDRCPDAYSYPTDDQTSTFNCPGGTNYRVVFCPY 281 PCTVFKTDQYCCNS SC PT+FSKFFKDRCPDA+SYP DDQTSTF CP GTNYRVVFCP Sbjct: 173 PCTVFKTDQYCCNSASCGPTNFSKFFKDRCPDAFSYPMDDQTSTFTCPAGTNYRVVFCPN 232 Query: 280 K 278 K Sbjct: 233 K 233 Score = 96.3 bits (238), Expect = 7e-18 Identities = 42/61 (68%), Positives = 49/61 (80%), Gaps = 2/61 (3%) Frame = -2 Query: 460 PCTVFKTDQYCCN--SGSCEPTSFSKFFKDRCPDAYSYPTDDQTSTFNCPGGTNYRVVFC 287 PCTVF+T +YCCN S SC T++S+FFKDRCPDA+SYP DD +TF CPGGTNY V FC Sbjct: 374 PCTVFRTTKYCCNNASESCGSTAYSQFFKDRCPDAFSYPRDD-PATFTCPGGTNYTVTFC 432 Query: 286 P 284 P Sbjct: 433 P 433 >ref|XP_009345456.1| PREDICTED: thaumatin-like protein [Pyrus x bretschneideri] Length = 225 Score = 125 bits (315), Expect = 8e-27 Identities = 52/59 (88%), Positives = 54/59 (91%) Frame = -2 Query: 460 PCTVFKTDQYCCNSGSCEPTSFSKFFKDRCPDAYSYPTDDQTSTFNCPGGTNYRVVFCP 284 PCTVFKTDQYCCNSG+C PT FSKFFK RCPDAYSYP DDQTSTF CPGGTNY+VVFCP Sbjct: 167 PCTVFKTDQYCCNSGNCGPTDFSKFFKSRCPDAYSYPKDDQTSTFTCPGGTNYKVVFCP 225 >gb|KCW77579.1| hypothetical protein EUGRSUZ_D01894 [Eucalyptus grandis] Length = 243 Score = 125 bits (315), Expect = 8e-27 Identities = 53/61 (86%), Positives = 55/61 (90%) Frame = -2 Query: 460 PCTVFKTDQYCCNSGSCEPTSFSKFFKDRCPDAYSYPTDDQTSTFNCPGGTNYRVVFCPY 281 PCTVFKTDQYCCNS SC PT+FSKFFKDRCPDA+SYP DDQTSTF CP GTNYRVVFCP Sbjct: 173 PCTVFKTDQYCCNSASCGPTNFSKFFKDRCPDAFSYPMDDQTSTFTCPAGTNYRVVFCPN 232 Query: 280 K 278 K Sbjct: 233 K 233 >gb|ADP69173.1| pathogenesis related protein-5 [Populus tomentosa] Length = 225 Score = 125 bits (315), Expect = 8e-27 Identities = 52/59 (88%), Positives = 54/59 (91%) Frame = -2 Query: 460 PCTVFKTDQYCCNSGSCEPTSFSKFFKDRCPDAYSYPTDDQTSTFNCPGGTNYRVVFCP 284 PCTVFKTDQYCCNSG+C PT FS+FFK RCPDAYSYP DDQTSTF CPGGTNYRVVFCP Sbjct: 167 PCTVFKTDQYCCNSGTCGPTDFSRFFKQRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 225 >emb|CAC22342.1| osmotin-like protein [Quercus robur] Length = 124 Score = 125 bits (314), Expect = 1e-26 Identities = 52/59 (88%), Positives = 55/59 (93%) Frame = -2 Query: 460 PCTVFKTDQYCCNSGSCEPTSFSKFFKDRCPDAYSYPTDDQTSTFNCPGGTNYRVVFCP 284 PCTVFKTD+YCCNSGSC PT++SKFFKDRCPDAYSYP DDQTSTF C GGTNYRVVFCP Sbjct: 66 PCTVFKTDEYCCNSGSCGPTNYSKFFKDRCPDAYSYPKDDQTSTFTCKGGTNYRVVFCP 124 >ref|XP_010054781.1| PREDICTED: thaumatin-like protein [Eucalyptus grandis] Length = 251 Score = 125 bits (313), Expect = 1e-26 Identities = 53/60 (88%), Positives = 55/60 (91%) Frame = -2 Query: 460 PCTVFKTDQYCCNSGSCEPTSFSKFFKDRCPDAYSYPTDDQTSTFNCPGGTNYRVVFCPY 281 PCTVFKTDQYCCNSGSC PT+FSKFFKDRCPDAYSYP DDQTSTF CPGGTNYRVVF + Sbjct: 167 PCTVFKTDQYCCNSGSCGPTNFSKFFKDRCPDAYSYPKDDQTSTFTCPGGTNYRVVFSTF 226 >gb|AAV34889.2| osmotin-like [Theobroma cacao] Length = 204 Score = 125 bits (313), Expect = 1e-26 Identities = 51/59 (86%), Positives = 54/59 (91%) Frame = -2 Query: 460 PCTVFKTDQYCCNSGSCEPTSFSKFFKDRCPDAYSYPTDDQTSTFNCPGGTNYRVVFCP 284 PCTVF+TDQYCCNSG+C PT FS+FFK RCPDAYSYP DDQTSTF CPGGTNYRVVFCP Sbjct: 146 PCTVFRTDQYCCNSGNCRPTDFSRFFKTRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 204 >ref|XP_007040162.1| Osmotin 34 [Theobroma cacao] gi|508777407|gb|EOY24663.1| Osmotin 34 [Theobroma cacao] Length = 224 Score = 125 bits (313), Expect = 1e-26 Identities = 51/59 (86%), Positives = 54/59 (91%) Frame = -2 Query: 460 PCTVFKTDQYCCNSGSCEPTSFSKFFKDRCPDAYSYPTDDQTSTFNCPGGTNYRVVFCP 284 PCTVF+TDQYCCNSG+C PT FS+FFK RCPDAYSYP DDQTSTF CPGGTNYRVVFCP Sbjct: 166 PCTVFRTDQYCCNSGNCRPTDFSRFFKTRCPDAYSYPKDDQTSTFTCPGGTNYRVVFCP 224 >emb|CDP09784.1| unnamed protein product [Coffea canephora] Length = 225 Score = 124 bits (312), Expect = 2e-26 Identities = 52/59 (88%), Positives = 53/59 (89%) Frame = -2 Query: 460 PCTVFKTDQYCCNSGSCEPTSFSKFFKDRCPDAYSYPTDDQTSTFNCPGGTNYRVVFCP 284 PCTVFKTDQYCCNSGSC T +SKFFKDRCPDAYSYP DDQTSTF CP GTNYRVVFCP Sbjct: 167 PCTVFKTDQYCCNSGSCSATDYSKFFKDRCPDAYSYPKDDQTSTFTCPAGTNYRVVFCP 225