BLASTX nr result
ID: Forsythia21_contig00001477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00001477 (299 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012848794.1| PREDICTED: cysteine proteinase RD19a-like [E... 93 8e-17 sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltNa... 92 1e-16 ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a [Vitis ... 91 4e-16 ref|XP_002280798.2| PREDICTED: cysteine proteinase 15A [Vitis vi... 91 4e-16 ref|XP_011028940.1| PREDICTED: cysteine proteinase 15A-like [Pop... 90 5e-16 gb|KHN39817.1| Cysteine proteinase RD19a [Glycine soja] 90 7e-16 gb|KDO84720.1| hypothetical protein CISIN_1g017548mg [Citrus sin... 90 7e-16 gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum ... 90 7e-16 ref|XP_006435090.1| hypothetical protein CICLE_v10001559mg [Citr... 90 7e-16 ref|XP_004507484.1| PREDICTED: probable cysteine proteinase A494... 90 7e-16 ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [G... 90 7e-16 ref|XP_006473584.1| PREDICTED: cysteine proteinase 15A-like [Cit... 89 9e-16 ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phas... 89 9e-16 emb|CDP20652.1| unnamed protein product [Coffea canephora] 89 1e-15 ref|XP_007160702.1| hypothetical protein PHAVU_001G009900g [Phas... 89 1e-15 ref|XP_007136047.1| hypothetical protein PHAVU_009G013600g [Phas... 89 1e-15 gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus... 89 1e-15 ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera]... 89 1e-15 ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Popu... 89 1e-15 gb|ABK94801.1| unknown [Populus trichocarpa] 89 1e-15 >ref|XP_012848794.1| PREDICTED: cysteine proteinase RD19a-like [Erythranthe guttatus] gi|604314938|gb|EYU27644.1| hypothetical protein MIMGU_mgv1a008452mg [Erythranthe guttata] Length = 373 Score = 92.8 bits (229), Expect = 8e-17 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -3 Query: 297 PYWIIKNSWGENWGESGYYKICRGHNSCGVDSLVSSVNAIHTTS 166 PYWI+KNSWGE+WGE GYYKIC+GHN CGV+S+VSSVNAIHTTS Sbjct: 329 PYWIVKNSWGESWGEEGYYKICKGHNVCGVESMVSSVNAIHTTS 372 >sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltName: Full=Clone PLBPC13, partial [Carica papaya] gi|18086|emb|CAA27609.1| pot. cysteine proteinase [Carica papaya] Length = 96 Score = 92.0 bits (227), Expect = 1e-16 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -3 Query: 297 PYWIIKNSWGENWGESGYYKICRGHNSCGVDSLVSSVNAIHTTSQ 163 PYW+IKNSWGENWGE+GYYKICRG N CGVDS+VS+V A+HTTSQ Sbjct: 52 PYWVIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTSQ 96 >ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera] gi|297735094|emb|CBI17456.3| unnamed protein product [Vitis vinifera] Length = 367 Score = 90.5 bits (223), Expect = 4e-16 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -3 Query: 297 PYWIIKNSWGENWGESGYYKICRGHNSCGVDSLVSSVNAIHTTSQ 163 PYWIIKNSWGE+WGE GYYKICRGHN+CGVDS+VS+V AI TT+Q Sbjct: 323 PYWIIKNSWGESWGEDGYYKICRGHNACGVDSMVSTVAAIQTTTQ 367 >ref|XP_002280798.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera] gi|147841854|emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera] gi|302142582|emb|CBI19785.3| unnamed protein product [Vitis vinifera] Length = 371 Score = 90.5 bits (223), Expect = 4e-16 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -3 Query: 297 PYWIIKNSWGENWGESGYYKICRGHNSCGVDSLVSSVNAIHTTS 166 PYWIIKNSWGE+WGE GYYKICRGHN CGVDS+VS+V AIHTT+ Sbjct: 327 PYWIIKNSWGESWGEQGYYKICRGHNICGVDSMVSTVAAIHTTA 370 >ref|XP_011028940.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica] Length = 367 Score = 90.1 bits (222), Expect = 5e-16 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -3 Query: 297 PYWIIKNSWGENWGESGYYKICRGHNSCGVDSLVSSVNAIHTTSQ 163 P+WIIKNSWGENWGE+GYYKICRG N CGVDS+VS+V AIHTT+Q Sbjct: 323 PFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAIHTTAQ 367 >gb|KHN39817.1| Cysteine proteinase RD19a [Glycine soja] Length = 332 Score = 89.7 bits (221), Expect = 7e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -3 Query: 297 PYWIIKNSWGENWGESGYYKICRGHNSCGVDSLVSSVNAIHTTSQ 163 P+WIIKNSWGENWGE+GYYKICRG N CGVDS+VS+V A+HTT+Q Sbjct: 288 PFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTTQ 332 >gb|KDO84720.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis] Length = 369 Score = 89.7 bits (221), Expect = 7e-16 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -3 Query: 297 PYWIIKNSWGENWGESGYYKICRGHNSCGVDSLVSSVNAIHTTS 166 PYWIIKNSWGENWGE+GYYKIC G N CGVDS+VSSV AIHTTS Sbjct: 325 PYWIIKNSWGENWGENGYYKICMGRNVCGVDSMVSSVAAIHTTS 368 >gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum melongena] Length = 363 Score = 89.7 bits (221), Expect = 7e-16 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -3 Query: 297 PYWIIKNSWGENWGESGYYKICRGHNSCGVDSLVSSVNAIHTTS 166 PYWIIKNSWGENWGE GYYKICRGHN CGVD++VS+V A HTT+ Sbjct: 317 PYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTATHTTN 360 >ref|XP_006435090.1| hypothetical protein CICLE_v10001559mg [Citrus clementina] gi|557537212|gb|ESR48330.1| hypothetical protein CICLE_v10001559mg [Citrus clementina] Length = 369 Score = 89.7 bits (221), Expect = 7e-16 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -3 Query: 297 PYWIIKNSWGENWGESGYYKICRGHNSCGVDSLVSSVNAIHTTS 166 PYWIIKNSWGENWGE+GYYKIC G N CGVDS+VSSV AIHTTS Sbjct: 325 PYWIIKNSWGENWGENGYYKICMGRNVCGVDSMVSSVAAIHTTS 368 >ref|XP_004507484.1| PREDICTED: probable cysteine proteinase A494 [Cicer arietinum] Length = 363 Score = 89.7 bits (221), Expect = 7e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -3 Query: 297 PYWIIKNSWGENWGESGYYKICRGHNSCGVDSLVSSVNAIHTTSQ 163 PYWIIKNSWGENWGE+G+YKICRG N CGVDS+VS+V A+HTT+Q Sbjct: 319 PYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAVHTTTQ 363 >ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max] Length = 363 Score = 89.7 bits (221), Expect = 7e-16 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -3 Query: 297 PYWIIKNSWGENWGESGYYKICRGHNSCGVDSLVSSVNAIHTTSQ 163 P+WIIKNSWGENWGE+GYYKICRG N CGVDS+VS+V A+HTT+Q Sbjct: 319 PFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTTQ 363 >ref|XP_006473584.1| PREDICTED: cysteine proteinase 15A-like [Citrus sinensis] Length = 369 Score = 89.4 bits (220), Expect = 9e-16 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = -3 Query: 297 PYWIIKNSWGENWGESGYYKICRGHNSCGVDSLVSSVNAIHTTS 166 PYWIIKNSWGENWGE+GYYKIC G N CGVDS+VSSV A+HTTS Sbjct: 325 PYWIIKNSWGENWGENGYYKICMGRNVCGVDSMVSSVAAVHTTS 368 >ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris] gi|561004787|gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris] Length = 361 Score = 89.4 bits (220), Expect = 9e-16 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -3 Query: 297 PYWIIKNSWGENWGESGYYKICRGHNSCGVDSLVSSVNAIHTTS 166 PYWIIKNSWGENWGE+GYYKICRG N CGVDS+VS+V A+HTT+ Sbjct: 317 PYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTT 360 >emb|CDP20652.1| unnamed protein product [Coffea canephora] Length = 372 Score = 89.0 bits (219), Expect = 1e-15 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = -3 Query: 297 PYWIIKNSWGENWGESGYYKICRGHNSCGVDSLVSSVNAIHTTS 166 PYWIIKNSWGE+WGE+GYYKICRGHN CGVDS+VS+V A+HT++ Sbjct: 329 PYWIIKNSWGEHWGENGYYKICRGHNICGVDSMVSTVAAVHTST 372 >ref|XP_007160702.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris] gi|561034166|gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris] Length = 365 Score = 89.0 bits (219), Expect = 1e-15 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -3 Query: 297 PYWIIKNSWGENWGESGYYKICRGHNSCGVDSLVSSVNAIHTTSQ 163 PYWIIKNSWGENWGE+GYYKICRG N CGVDS+VS+V AIH ++Q Sbjct: 321 PYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVGAIHASTQ 365 >ref|XP_007136047.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris] gi|561009134|gb|ESW08041.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris] Length = 366 Score = 89.0 bits (219), Expect = 1e-15 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = -3 Query: 297 PYWIIKNSWGENWGESGYYKICRGHNSCGVDSLVSSVNAIHTTS 166 P+WIIKNSWGE+WGE+GYYKICRGHN CGVDS+VS+V AIHT+S Sbjct: 322 PFWIIKNSWGESWGENGYYKICRGHNVCGVDSMVSTVAAIHTSS 365 >gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus vulgaris] Length = 366 Score = 89.0 bits (219), Expect = 1e-15 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = -3 Query: 297 PYWIIKNSWGENWGESGYYKICRGHNSCGVDSLVSSVNAIHTTS 166 P+WIIKNSWGE+WGE+GYYKICRGHN CGVDS+VS+V AIHT+S Sbjct: 322 PFWIIKNSWGESWGENGYYKICRGHNVCGVDSMVSTVAAIHTSS 365 >ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera] gi|161778780|gb|ABX79341.1| cysteine protease [Vitis vinifera] Length = 377 Score = 89.0 bits (219), Expect = 1e-15 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -3 Query: 297 PYWIIKNSWGENWGESGYYKICRGHNSCGVDSLVSSVNAIHTTS 166 PYWIIKNSWGENWGE+G+YKICRG N CGVDS+VS+V A+HTTS Sbjct: 333 PYWIIKNSWGENWGENGFYKICRGRNVCGVDSMVSTVAAVHTTS 376 >ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa] gi|118485796|gb|ABK94746.1| unknown [Populus trichocarpa] gi|550344165|gb|EEE81277.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa] Length = 367 Score = 89.0 bits (219), Expect = 1e-15 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -3 Query: 297 PYWIIKNSWGENWGESGYYKICRGHNSCGVDSLVSSVNAIHTTSQ 163 P+WIIKNSWG+NWGE+GYYKICRG N CGVDS+VS+V AIHTT+Q Sbjct: 323 PFWIIKNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAIHTTAQ 367 >gb|ABK94801.1| unknown [Populus trichocarpa] Length = 367 Score = 89.0 bits (219), Expect = 1e-15 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -3 Query: 297 PYWIIKNSWGENWGESGYYKICRGHNSCGVDSLVSSVNAIHTTSQ 163 P+WIIKNSWG+NWGE+GYYKICRG N CGVDS+VS+V AIHTT+Q Sbjct: 323 PFWIIKNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAIHTTAQ 367