BLASTX nr result
ID: Ephedra29_contig00028105
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00028105 (242 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AGI65359.1 cytochrome p450 family CYP711A member [Picea glauca] 92 5e-20 JAT64539.1 Thromboxane-A synthase, partial [Anthurium amnicola] 77 7e-15 XP_015972225.1 PREDICTED: cytochrome P450 711A1 [Arachis duranen... 77 1e-14 XP_016162866.1 PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 7... 77 1e-14 XP_012570725.1 PREDICTED: cytochrome P450 711A1 isoform X2 [Cice... 76 2e-14 XP_014498494.1 PREDICTED: cytochrome P450 711A1-like [Vigna radi... 76 2e-14 XP_004498873.1 PREDICTED: cytochrome P450 711A1 isoform X1 [Cice... 76 2e-14 XP_017422869.1 PREDICTED: cytochrome P450 711A1-like [Vigna angu... 76 2e-14 XP_015083325.1 PREDICTED: cytochrome P450 711A1 [Solanum pennellii] 76 3e-14 XP_004245085.1 PREDICTED: cytochrome P450 711A1 [Solanum lycoper... 76 3e-14 XP_013465887.1 cytochrome P450 family protein [Medicago truncatu... 75 3e-14 XP_003588968.2 cytochrome P450 family protein [Medicago truncatu... 75 4e-14 XP_003523646.1 PREDICTED: cytochrome P450 711A1-like [Glycine ma... 75 4e-14 KHN29714.1 Thromboxane-A synthase [Glycine soja] 75 4e-14 XP_006351579.1 PREDICTED: cytochrome P450 711A1 [Solanum tuberosum] 75 5e-14 XP_004501462.1 PREDICTED: cytochrome P450 711A1-like [Cicer arie... 75 7e-14 KOM48855.1 hypothetical protein LR48_Vigan07g255900 [Vigna angul... 74 9e-14 XP_017429907.1 PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 7... 74 9e-14 XP_014503687.1 PREDICTED: cytochrome P450 711A1 isoform X2 [Vign... 74 9e-14 BAT82493.1 hypothetical protein VIGAN_03252200 [Vigna angularis ... 74 9e-14 >AGI65359.1 cytochrome p450 family CYP711A member [Picea glauca] Length = 544 Score = 92.0 bits (227), Expect = 5e-20 Identities = 36/53 (67%), Positives = 48/53 (90%) Frame = +1 Query: 82 WVYSAMPTWRLRRIPAPPSHFLLGHLPLLASQGPDVFIHLARQYGPLYRFNMG 240 W+Y A+PTW++RR+P+PP+ +LLGHLPLLA GP+VFI LAR+YGP+YRFN+G Sbjct: 46 WIYLAIPTWKVRRVPSPPAFWLLGHLPLLAKHGPEVFIQLARKYGPIYRFNIG 98 >JAT64539.1 Thromboxane-A synthase, partial [Anthurium amnicola] Length = 559 Score = 77.4 bits (189), Expect = 7e-15 Identities = 34/52 (65%), Positives = 41/52 (78%) Frame = +1 Query: 85 VYSAMPTWRLRRIPAPPSHFLLGHLPLLASQGPDVFIHLARQYGPLYRFNMG 240 VY P WR+R++P PP+ LLGHLPLLA GPDVF LA+QYGP+YRF+MG Sbjct: 54 VYLYAPYWRVRKVPGPPTTPLLGHLPLLAKYGPDVFSLLAKQYGPIYRFHMG 105 >XP_015972225.1 PREDICTED: cytochrome P450 711A1 [Arachis duranensis] Length = 492 Score = 77.0 bits (188), Expect = 1e-14 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = +1 Query: 100 PTWRLRRIPAPPSHFLLGHLPLLASQGPDVFIHLARQYGPLYRFNMG 240 P WRLRR+P PPS L+GHLPLLA GPDVF LA+QYGP+YRF+MG Sbjct: 38 PYWRLRRVPGPPSLPLVGHLPLLAKYGPDVFSVLAKQYGPIYRFHMG 84 >XP_016162866.1 PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 711A1-like [Arachis ipaensis] Length = 542 Score = 77.0 bits (188), Expect = 1e-14 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = +1 Query: 100 PTWRLRRIPAPPSHFLLGHLPLLASQGPDVFIHLARQYGPLYRFNMG 240 P WRLRR+P PPS L+GHLPLLA GPDVF LA+QYGP+YRF+MG Sbjct: 38 PYWRLRRVPGPPSLPLVGHLPLLAKYGPDVFSVLAKQYGPIYRFHMG 84 >XP_012570725.1 PREDICTED: cytochrome P450 711A1 isoform X2 [Cicer arietinum] Length = 430 Score = 76.3 bits (186), Expect = 2e-14 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = +1 Query: 100 PTWRLRRIPAPPSHFLLGHLPLLASQGPDVFIHLARQYGPLYRFNMG 240 P WRLR++P PPS L+GHLPLLA GPDVF LA+QYGP+YRF+MG Sbjct: 32 PIWRLRKVPGPPSLPLVGHLPLLAKYGPDVFSVLAKQYGPIYRFHMG 78 >XP_014498494.1 PREDICTED: cytochrome P450 711A1-like [Vigna radiata var. radiata] Length = 511 Score = 76.3 bits (186), Expect = 2e-14 Identities = 33/53 (62%), Positives = 42/53 (79%) Frame = +1 Query: 82 WVYSAMPTWRLRRIPAPPSHFLLGHLPLLASQGPDVFIHLARQYGPLYRFNMG 240 ++Y P W +R++PAPPS L+GHLPLLA GPDVF LA+QYGP+YRF+MG Sbjct: 13 FLYLYAPYWGVRKVPAPPSFPLIGHLPLLAKYGPDVFSVLAKQYGPIYRFHMG 65 >XP_004498873.1 PREDICTED: cytochrome P450 711A1 isoform X1 [Cicer arietinum] Length = 527 Score = 76.3 bits (186), Expect = 2e-14 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = +1 Query: 100 PTWRLRRIPAPPSHFLLGHLPLLASQGPDVFIHLARQYGPLYRFNMG 240 P WRLR++P PPS L+GHLPLLA GPDVF LA+QYGP+YRF+MG Sbjct: 32 PIWRLRKVPGPPSLPLVGHLPLLAKYGPDVFSVLAKQYGPIYRFHMG 78 >XP_017422869.1 PREDICTED: cytochrome P450 711A1-like [Vigna angularis] KOM42154.1 hypothetical protein LR48_Vigan04g235200 [Vigna angularis] BAT77989.1 hypothetical protein VIGAN_02061000 [Vigna angularis var. angularis] Length = 536 Score = 76.3 bits (186), Expect = 2e-14 Identities = 34/53 (64%), Positives = 42/53 (79%) Frame = +1 Query: 82 WVYSAMPTWRLRRIPAPPSHFLLGHLPLLASQGPDVFIHLARQYGPLYRFNMG 240 +VY P W +R++PAPPS L+GHLPLLA GPDVF LA+QYGP+YRF+MG Sbjct: 29 FVYLYAPYWGVRKVPAPPSLPLVGHLPLLAKYGPDVFSVLAKQYGPIYRFHMG 81 >XP_015083325.1 PREDICTED: cytochrome P450 711A1 [Solanum pennellii] Length = 519 Score = 75.9 bits (185), Expect = 3e-14 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = +1 Query: 85 VYSAMPTWRLRRIPAPPSHFLLGHLPLLASQGPDVFIHLARQYGPLYRFNMG 240 VY P WR+R++P PP+ L+GHLPL+A GPDVF LA+QYGP+YRF+MG Sbjct: 26 VYLYRPYWRVRKVPGPPAFPLVGHLPLMAKYGPDVFSVLAKQYGPIYRFHMG 77 >XP_004245085.1 PREDICTED: cytochrome P450 711A1 [Solanum lycopersicum] Length = 519 Score = 75.9 bits (185), Expect = 3e-14 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = +1 Query: 85 VYSAMPTWRLRRIPAPPSHFLLGHLPLLASQGPDVFIHLARQYGPLYRFNMG 240 VY P WR+R++P PP+ L+GHLPL+A GPDVF LA+QYGP+YRF+MG Sbjct: 26 VYLYRPYWRVRKVPGPPAFPLVGHLPLMAKYGPDVFSVLAKQYGPIYRFHMG 77 >XP_013465887.1 cytochrome P450 family protein [Medicago truncatula] KEH39923.1 cytochrome P450 family protein [Medicago truncatula] Length = 441 Score = 75.5 bits (184), Expect = 3e-14 Identities = 33/51 (64%), Positives = 40/51 (78%) Frame = +1 Query: 88 YSAMPTWRLRRIPAPPSHFLLGHLPLLASQGPDVFIHLARQYGPLYRFNMG 240 Y P W+LR++P PPS L+GHLPLLA GPDVF LA+QYGP+YRF+MG Sbjct: 29 YLYWPFWKLRKVPGPPSLPLVGHLPLLAKYGPDVFSVLAKQYGPIYRFHMG 79 >XP_003588968.2 cytochrome P450 family protein [Medicago truncatula] AGI65361.1 cytochrome p450 family CYP711A member [Medicago truncatula] AES59219.2 cytochrome P450 family protein [Medicago truncatula] Length = 529 Score = 75.5 bits (184), Expect = 4e-14 Identities = 33/51 (64%), Positives = 40/51 (78%) Frame = +1 Query: 88 YSAMPTWRLRRIPAPPSHFLLGHLPLLASQGPDVFIHLARQYGPLYRFNMG 240 Y P W+LR++P PPS L+GHLPLLA GPDVF LA+QYGP+YRF+MG Sbjct: 29 YLYWPFWKLRKVPGPPSLPLVGHLPLLAKYGPDVFSVLAKQYGPIYRFHMG 79 >XP_003523646.1 PREDICTED: cytochrome P450 711A1-like [Glycine max] KRH61519.1 hypothetical protein GLYMA_04G052100 [Glycine max] KRH61520.1 hypothetical protein GLYMA_04G052100 [Glycine max] KRH61521.1 hypothetical protein GLYMA_04G052100 [Glycine max] Length = 548 Score = 75.5 bits (184), Expect = 4e-14 Identities = 34/52 (65%), Positives = 40/52 (76%) Frame = +1 Query: 85 VYSAMPTWRLRRIPAPPSHFLLGHLPLLASQGPDVFIHLARQYGPLYRFNMG 240 VY P W LR++P PPS L+GHLPLLA GPDVF LA+QYGP+YRF+MG Sbjct: 35 VYLYAPYWGLRKVPGPPSLPLVGHLPLLAKYGPDVFSVLAKQYGPIYRFHMG 86 >KHN29714.1 Thromboxane-A synthase [Glycine soja] Length = 550 Score = 75.5 bits (184), Expect = 4e-14 Identities = 34/52 (65%), Positives = 40/52 (76%) Frame = +1 Query: 85 VYSAMPTWRLRRIPAPPSHFLLGHLPLLASQGPDVFIHLARQYGPLYRFNMG 240 VY P W LR++P PPS L+GHLPLLA GPDVF LA+QYGP+YRF+MG Sbjct: 35 VYLYAPYWGLRKVPGPPSLPLVGHLPLLAKYGPDVFSVLAKQYGPIYRFHMG 86 >XP_006351579.1 PREDICTED: cytochrome P450 711A1 [Solanum tuberosum] Length = 519 Score = 75.1 bits (183), Expect = 5e-14 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = +1 Query: 85 VYSAMPTWRLRRIPAPPSHFLLGHLPLLASQGPDVFIHLARQYGPLYRFNMG 240 VY P WR+R++P PP+ L+GHLPL+A GPDVF LA+QYGP+YRF+MG Sbjct: 26 VYLYGPYWRVRKVPGPPAFPLVGHLPLMAKYGPDVFSVLAKQYGPIYRFHMG 77 >XP_004501462.1 PREDICTED: cytochrome P450 711A1-like [Cicer arietinum] Length = 543 Score = 74.7 bits (182), Expect = 7e-14 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = +1 Query: 85 VYSAMPTWRLRRIPAPPSHFLLGHLPLLASQGPDVFIHLARQYGPLYRFNMG 240 +Y P WR+R++P PPS L+GHLPLLA GPD+F LA+QYGP+YRF+MG Sbjct: 33 IYLYGPYWRVRKVPGPPSLPLVGHLPLLAKYGPDMFSILAKQYGPIYRFHMG 84 >KOM48855.1 hypothetical protein LR48_Vigan07g255900 [Vigna angularis] Length = 478 Score = 74.3 bits (181), Expect = 9e-14 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = +1 Query: 100 PTWRLRRIPAPPSHFLLGHLPLLASQGPDVFIHLARQYGPLYRFNMG 240 P W LR++P PPS LLGHL LLA GPDVF HLA QYGP+YRF+MG Sbjct: 32 PYWGLRKVPGPPSLPLLGHLHLLAKYGPDVFSHLANQYGPIYRFHMG 78 >XP_017429907.1 PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 711A1 [Vigna angularis] Length = 497 Score = 74.3 bits (181), Expect = 9e-14 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = +1 Query: 100 PTWRLRRIPAPPSHFLLGHLPLLASQGPDVFIHLARQYGPLYRFNMG 240 P W LR++P PPS LLGHL LLA GPDVF HLA QYGP+YRF+MG Sbjct: 30 PYWGLRKVPGPPSLPLLGHLHLLAKYGPDVFSHLANQYGPIYRFHMG 76 >XP_014503687.1 PREDICTED: cytochrome P450 711A1 isoform X2 [Vigna radiata var. radiata] Length = 528 Score = 74.3 bits (181), Expect = 9e-14 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = +1 Query: 100 PTWRLRRIPAPPSHFLLGHLPLLASQGPDVFIHLARQYGPLYRFNMG 240 P W LR++P PPS LLGHL LLA GPDVF HLA QYGP+YRF+MG Sbjct: 30 PYWGLRKVPGPPSLPLLGHLHLLAKYGPDVFSHLANQYGPIYRFHMG 76 >BAT82493.1 hypothetical protein VIGAN_03252200 [Vigna angularis var. angularis] Length = 531 Score = 74.3 bits (181), Expect = 9e-14 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = +1 Query: 100 PTWRLRRIPAPPSHFLLGHLPLLASQGPDVFIHLARQYGPLYRFNMG 240 P W LR++P PPS LLGHL LLA GPDVF HLA QYGP+YRF+MG Sbjct: 32 PYWGLRKVPGPPSLPLLGHLHLLAKYGPDVFSHLANQYGPIYRFHMG 78