BLASTX nr result
ID: Ephedra29_contig00027899
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00027899 (368 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008386462.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 2e-07 XP_009367606.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 2e-07 >XP_008386462.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Malus domestica] XP_008350052.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Malus domestica] Length = 782 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = +2 Query: 32 YSQYYHSILTCHFKSGELDSAAGVILEMINRAKAAQKSFEEGTSVKDCTDKG 187 Y Q+Y+ +LTCH K G+LDSA+ ++LEM+ +AKAA+ S T V D KG Sbjct: 322 YRQFYNCLLTCHLKFGDLDSASNMVLEMLRKAKAARNSLAVATLVFDAAGKG 373 >XP_009367606.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Pyrus x bretschneideri] Length = 785 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = +2 Query: 32 YSQYYHSILTCHFKSGELDSAAGVILEMINRAKAAQKSFEEGTSVKDCTDKG 187 Y Q+Y+ +LTCH K G+LDSA+ ++LEM+ +AKAA+ S T V D KG Sbjct: 322 YRQFYNCLLTCHLKFGDLDSASNMVLEMLRKAKAARSSLAVATLVFDAAGKG 373