BLASTX nr result
ID: Ephedra29_contig00027810
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00027810 (434 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_020127465.1 peptidase c19 ubiquitin carboxyl-terminal hydrola... 55 7e-06 >XP_020127465.1 peptidase c19 ubiquitin carboxyl-terminal hydrolase 2 [Diplodia corticola] OJD31205.1 peptidase c19 ubiquitin carboxyl-terminal hydrolase 2 [Diplodia corticola] Length = 932 Score = 54.7 bits (130), Expect = 7e-06 Identities = 32/83 (38%), Positives = 45/83 (54%), Gaps = 9/83 (10%) Frame = -3 Query: 225 LPYELISVVEHHGTFQDGHYTVYRKLKL--------STEQPLQKG-YEKNERNAQSREIN 73 LPYEL +VV H+G ++GHY YRK +TEQ +G E+ E E Sbjct: 497 LPYELRAVVAHYGRHENGHYICYRKHPFTADQVDGANTEQKESEGSKEETEGETFKEETE 556 Query: 72 DHFQQSKPQILWFRISDSDVQRV 4 D + KP++ W+R+SD DV +V Sbjct: 557 DEESKEKPEV-WWRLSDEDVSQV 578