BLASTX nr result
ID: Ephedra29_contig00027520
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00027520 (425 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AIF75766.1 cellulose synthase, partial [Pinus massoniana] AIF757... 64 3e-10 AEW70215.1 cellulose synthase, partial [Pinus sylvestris var. mo... 64 3e-10 ACR37507.1 unknown [Zea mays] 62 1e-09 KZM82060.1 hypothetical protein DCAR_029673 [Daucus carota subsp... 64 3e-09 XP_017226278.1 PREDICTED: cellulose synthase A catalytic subunit... 64 3e-09 XP_010228019.1 PREDICTED: probable cellulose synthase A catalyti... 64 4e-09 KQK12571.1 hypothetical protein BRADI_1g04597 [Brachypodium dist... 64 4e-09 KQK12573.1 hypothetical protein BRADI_1g04597 [Brachypodium dist... 64 4e-09 AAR29963.1 putative cellulose synthase catalytic subunit, partia... 64 4e-09 XP_010228016.1 PREDICTED: probable cellulose synthase A catalyti... 64 4e-09 BAJ96780.1 predicted protein [Hordeum vulgare subsp. vulgare] 64 4e-09 XP_010228012.1 PREDICTED: probable cellulose synthase A catalyti... 64 4e-09 AGV22107.1 cellulose synthase 2 [Betula luminifera] 64 4e-09 AAQ63935.1 cellulose synthase [Pinus radiata] 64 4e-09 ONK59719.1 uncharacterized protein A4U43_C08F9680 [Asparagus off... 62 4e-09 KZM90238.1 hypothetical protein DCAR_022397 [Daucus carota subsp... 64 5e-09 AAQ63936.1 cellulose synthase, partial [Pinus radiata] 64 5e-09 XP_017258258.1 PREDICTED: cellulose synthase A catalytic subunit... 64 5e-09 KHG16921.1 Cellulose synthase A catalytic subunit 3 [UDP-forming... 63 7e-09 XP_017625947.1 PREDICTED: cellulose synthase A catalytic subunit... 63 7e-09 >AIF75766.1 cellulose synthase, partial [Pinus massoniana] AIF75767.1 cellulose synthase, partial [Pinus massoniana] AIF75768.1 cellulose synthase, partial [Pinus massoniana] AIF75769.1 cellulose synthase, partial [Pinus massoniana] AIF75770.1 cellulose synthase, partial [Pinus massoniana] AIF75771.1 cellulose synthase, partial [Pinus hwangshanensis] AIF75772.1 cellulose synthase, partial [Pinus hwangshanensis] AIF75773.1 cellulose synthase, partial [Pinus hwangshanensis] AIF75774.1 cellulose synthase, partial [Pinus hwangshanensis] AIF75775.1 cellulose synthase, partial [Pinus hwangshanensis] Length = 125 Score = 63.5 bits (153), Expect = 3e-10 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 424 LASIFSLLWVRIDPFTTKVRGPDLQLCGINC 332 LASIFSLLWVRIDPFTT+++GPDLQ CGINC Sbjct: 95 LASIFSLLWVRIDPFTTQIKGPDLQQCGINC 125 >AEW70215.1 cellulose synthase, partial [Pinus sylvestris var. mongolica] AEW70216.1 cellulose synthase, partial [Pinus densiflora var. densiflora] AEW70217.1 cellulose synthase, partial [Pinus densiflora var. densiflora] AEW70218.1 cellulose synthase, partial [Pinus densiflora var. densiflora] AEW70219.1 cellulose synthase, partial [Pinus densiflora var. densiflora] AEW70220.1 cellulose synthase, partial [Pinus densiflora var. densiflora] AEW70221.1 cellulose synthase, partial [Pinus densiflora] AEW70222.1 cellulose synthase, partial [Pinus sylvestris var. mongolica] Length = 127 Score = 63.5 bits (153), Expect = 3e-10 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 424 LASIFSLLWVRIDPFTTKVRGPDLQLCGINC 332 LASIFSLLWVRIDPFTT+++GPDLQ CGINC Sbjct: 97 LASIFSLLWVRIDPFTTQIKGPDLQQCGINC 127 >ACR37507.1 unknown [Zea mays] Length = 109 Score = 61.6 bits (148), Expect = 1e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 424 LASIFSLLWVRIDPFTTKVRGPDLQLCGINC 332 LASIFSLLWVRIDPFTT+V GPD Q CGINC Sbjct: 79 LASIFSLLWVRIDPFTTRVTGPDTQTCGINC 109 >KZM82060.1 hypothetical protein DCAR_029673 [Daucus carota subsp. sativus] Length = 1034 Score = 64.3 bits (155), Expect = 3e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 424 LASIFSLLWVRIDPFTTKVRGPDLQLCGINC 332 LASIFSLLWVRIDPFTT+V GPD+QLCGINC Sbjct: 1004 LASIFSLLWVRIDPFTTRVTGPDVQLCGINC 1034 >XP_017226278.1 PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] [Daucus carota subsp. sativus] Length = 1076 Score = 64.3 bits (155), Expect = 3e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 424 LASIFSLLWVRIDPFTTKVRGPDLQLCGINC 332 LASIFSLLWVRIDPFTT+V GPD+QLCGINC Sbjct: 1046 LASIFSLLWVRIDPFTTRVTGPDVQLCGINC 1076 >XP_010228019.1 PREDICTED: probable cellulose synthase A catalytic subunit 2 [UDP-forming] isoform X3 [Brachypodium distachyon] Length = 931 Score = 63.9 bits (154), Expect = 4e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 424 LASIFSLLWVRIDPFTTKVRGPDLQLCGINC 332 LASIFSLLWVRIDPFTT+V GPD+Q+CGINC Sbjct: 901 LASIFSLLWVRIDPFTTRVTGPDIQMCGINC 931 >KQK12571.1 hypothetical protein BRADI_1g04597 [Brachypodium distachyon] Length = 967 Score = 63.9 bits (154), Expect = 4e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 424 LASIFSLLWVRIDPFTTKVRGPDLQLCGINC 332 LASIFSLLWVRIDPFTT+V GPD+Q+CGINC Sbjct: 937 LASIFSLLWVRIDPFTTRVTGPDIQMCGINC 967 >KQK12573.1 hypothetical protein BRADI_1g04597 [Brachypodium distachyon] Length = 1016 Score = 63.9 bits (154), Expect = 4e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 424 LASIFSLLWVRIDPFTTKVRGPDLQLCGINC 332 LASIFSLLWVRIDPFTT+V GPD+Q+CGINC Sbjct: 986 LASIFSLLWVRIDPFTTRVTGPDIQMCGINC 1016 >AAR29963.1 putative cellulose synthase catalytic subunit, partial [Hordeum vulgare] Length = 1051 Score = 63.9 bits (154), Expect = 4e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 424 LASIFSLLWVRIDPFTTKVRGPDLQLCGINC 332 LASIFSLLWVRIDPFTT+V GPD+Q+CGINC Sbjct: 1021 LASIFSLLWVRIDPFTTRVTGPDIQMCGINC 1051 >XP_010228016.1 PREDICTED: probable cellulose synthase A catalytic subunit 2 [UDP-forming] isoform X2 [Brachypodium distachyon] Length = 1068 Score = 63.9 bits (154), Expect = 4e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 424 LASIFSLLWVRIDPFTTKVRGPDLQLCGINC 332 LASIFSLLWVRIDPFTT+V GPD+Q+CGINC Sbjct: 1038 LASIFSLLWVRIDPFTTRVTGPDIQMCGINC 1068 >BAJ96780.1 predicted protein [Hordeum vulgare subsp. vulgare] Length = 1068 Score = 63.9 bits (154), Expect = 4e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 424 LASIFSLLWVRIDPFTTKVRGPDLQLCGINC 332 LASIFSLLWVRIDPFTT+V GPD+Q+CGINC Sbjct: 1038 LASIFSLLWVRIDPFTTRVTGPDIQMCGINC 1068 >XP_010228012.1 PREDICTED: probable cellulose synthase A catalytic subunit 2 [UDP-forming] isoform X1 [Brachypodium distachyon] KQK12572.1 hypothetical protein BRADI_1g04597 [Brachypodium distachyon] Length = 1078 Score = 63.9 bits (154), Expect = 4e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 424 LASIFSLLWVRIDPFTTKVRGPDLQLCGINC 332 LASIFSLLWVRIDPFTT+V GPD+Q+CGINC Sbjct: 1048 LASIFSLLWVRIDPFTTRVTGPDIQMCGINC 1078 >AGV22107.1 cellulose synthase 2 [Betula luminifera] Length = 1084 Score = 63.9 bits (154), Expect = 4e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 424 LASIFSLLWVRIDPFTTKVRGPDLQLCGINC 332 LASIFSLLWVR+DPFTT+V GPD+QLCGINC Sbjct: 1054 LASIFSLLWVRVDPFTTRVTGPDVQLCGINC 1084 >AAQ63935.1 cellulose synthase [Pinus radiata] Length = 1096 Score = 63.9 bits (154), Expect = 4e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 424 LASIFSLLWVRIDPFTTKVRGPDLQLCGINC 332 LASIFSLLWVRIDPFTT+++GPDLQ CGINC Sbjct: 1066 LASIFSLLWVRIDPFTTRIKGPDLQQCGINC 1096 >ONK59719.1 uncharacterized protein A4U43_C08F9680 [Asparagus officinalis] Length = 171 Score = 61.6 bits (148), Expect = 4e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 424 LASIFSLLWVRIDPFTTKVRGPDLQLCGINC 332 LASIFSLLWVR+DPFTT+V GPD+Q CGINC Sbjct: 141 LASIFSLLWVRVDPFTTRVTGPDVQQCGINC 171 >KZM90238.1 hypothetical protein DCAR_022397 [Daucus carota subsp. sativus] Length = 1039 Score = 63.5 bits (153), Expect = 5e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 424 LASIFSLLWVRIDPFTTKVRGPDLQLCGINC 332 LASIFSLLWVRIDPFTT+V GPD QLCGINC Sbjct: 1009 LASIFSLLWVRIDPFTTRVTGPDTQLCGINC 1039 >AAQ63936.1 cellulose synthase, partial [Pinus radiata] Length = 1066 Score = 63.5 bits (153), Expect = 5e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 424 LASIFSLLWVRIDPFTTKVRGPDLQLCGINC 332 LASIFSLLWVRIDPFTT+++GPDLQ CGINC Sbjct: 1036 LASIFSLLWVRIDPFTTQIKGPDLQQCGINC 1066 >XP_017258258.1 PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Daucus carota subsp. sativus] Length = 1081 Score = 63.5 bits (153), Expect = 5e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 424 LASIFSLLWVRIDPFTTKVRGPDLQLCGINC 332 LASIFSLLWVRIDPFTT+V GPD QLCGINC Sbjct: 1051 LASIFSLLWVRIDPFTTRVTGPDTQLCGINC 1081 >KHG16921.1 Cellulose synthase A catalytic subunit 3 [UDP-forming] [Gossypium arboreum] Length = 1064 Score = 63.2 bits (152), Expect = 7e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 424 LASIFSLLWVRIDPFTTKVRGPDLQLCGINC 332 LASIFSLLWVRIDPFTT+V GPD++LCGINC Sbjct: 1034 LASIFSLLWVRIDPFTTRVTGPDVELCGINC 1064 >XP_017625947.1 PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Gossypium arboreum] XP_017625948.1 PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Gossypium arboreum] XP_017625949.1 PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Gossypium arboreum] XP_017625950.1 PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Gossypium arboreum] Length = 1067 Score = 63.2 bits (152), Expect = 7e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 424 LASIFSLLWVRIDPFTTKVRGPDLQLCGINC 332 LASIFSLLWVRIDPFTT+V GPD++LCGINC Sbjct: 1037 LASIFSLLWVRIDPFTTRVTGPDVELCGINC 1067