BLASTX nr result
ID: Ephedra29_contig00027450
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00027450 (513 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAE22934.1 hypothetical protein AXG93_2284s1020 [Marchantia poly... 68 3e-10 AEW08133.1 hypothetical protein 2_645_01, partial [Pinus radiata... 61 9e-09 ADE75918.1 unknown [Picea sitchensis] 54 3e-06 XP_002462488.1 hypothetical protein SORBIDRAFT_02g026580 [Sorghu... 56 3e-06 XP_002991168.1 hypothetical protein SELMODRAFT_429511 [Selaginel... 55 6e-06 >OAE22934.1 hypothetical protein AXG93_2284s1020 [Marchantia polymorpha subsp. polymorpha] Length = 664 Score = 68.2 bits (165), Expect = 3e-10 Identities = 41/137 (29%), Positives = 72/137 (52%), Gaps = 26/137 (18%) Frame = +3 Query: 9 ARRIEFWSDLIENKSALNVAPSHGLFAQAKENKNVSCFN-----------------PMWA 137 ARRIEFWS++ E +++ N+ S LF+ K + +++ F+ P W Sbjct: 388 ARRIEFWSEVTEKRNSSNLLASENLFSAHKVDVDLANFSPRCAEDQALTPYRNTFLPKWL 447 Query: 138 RRYAEEIGVELRQAGWTDTEVAEMLSP-PTPTAVRKVQ-GRENLMHELA-------TSLR 290 Y E+I + LR+ GW + E+ EM+ P P P V+ +++++ LA +LR Sbjct: 448 VNYFEDITLRLRKGGWKEAEIDEMMDPHPLPKKVQDSSVDKQSVLDSLARQAEIIQATLR 507 Query: 291 NAGWSAQDVMELFSVNV 341 AGWS +DV ++ + ++ Sbjct: 508 AAGWSMRDVADVLTADL 524 >AEW08133.1 hypothetical protein 2_645_01, partial [Pinus radiata] AFG59748.1 hypothetical protein 2_645_01, partial [Pinus taeda] AFG59749.1 hypothetical protein 2_645_01, partial [Pinus taeda] AFG59750.1 hypothetical protein 2_645_01, partial [Pinus taeda] AFG59751.1 hypothetical protein 2_645_01, partial [Pinus taeda] AFG59752.1 hypothetical protein 2_645_01, partial [Pinus taeda] AFG59753.1 hypothetical protein 2_645_01, partial [Pinus taeda] AFG59754.1 hypothetical protein 2_645_01, partial [Pinus taeda] AFG59755.1 hypothetical protein 2_645_01, partial [Pinus taeda] AFG59756.1 hypothetical protein 2_645_01, partial [Pinus taeda] AFG59757.1 hypothetical protein 2_645_01, partial [Pinus taeda] AFG59758.1 hypothetical protein 2_645_01, partial [Pinus taeda] AFG59759.1 hypothetical protein 2_645_01, partial [Pinus taeda] AFG59760.1 hypothetical protein 2_645_01, partial [Pinus taeda] AFG59761.1 hypothetical protein 2_645_01, partial [Pinus taeda] Length = 140 Score = 60.8 bits (146), Expect = 9e-09 Identities = 30/84 (35%), Positives = 42/84 (50%), Gaps = 19/84 (22%) Frame = +3 Query: 3 KGARRIEFWSDLIENKSALNVAPSHGLFAQAKENKNV-------------------SCFN 125 K AR+I+FWSDL+E K LN+AP GLF+ K + ++ +CF+ Sbjct: 57 KAARKIDFWSDLVEKKQVLNIAPPEGLFSSVKVDVDLANSAKKQASFDEKTLPEARNCFS 116 Query: 126 PMWARRYAEEIGVELRQAGWTDTE 197 W Y +IG LR GW + E Sbjct: 117 RKWLAGYLGDIGSRLRNGGWKEDE 140 >ADE75918.1 unknown [Picea sitchensis] Length = 110 Score = 53.5 bits (127), Expect = 3e-06 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 10/91 (10%) Frame = +3 Query: 126 PMWARRYAEEIGVELRQAGWTDTEVAEML----SPPTPTAVRKVQGR---ENLMHE---L 275 P W Y EE+ LR GW + ++ +M+ SP + T + + E L+ + + Sbjct: 2 PRWLMDYLEELATLLRNGGWKEQDINDMIQASSSPSSDTEDIYLDSQTILEGLLLKADLM 61 Query: 276 ATSLRNAGWSAQDVMELFSVNVNTEQ*LRKI 368 + SLR AGWS+QD+ E+F +N T++ +KI Sbjct: 62 SNSLRKAGWSSQDIAEIFDINYPTKKPTKKI 92 >XP_002462488.1 hypothetical protein SORBIDRAFT_02g026580 [Sorghum bicolor] EER99009.1 hypothetical protein SORBI_002G225200 [Sorghum bicolor] Length = 412 Score = 56.2 bits (134), Expect = 3e-06 Identities = 34/128 (26%), Positives = 56/128 (43%), Gaps = 19/128 (14%) Frame = +3 Query: 12 RRIEFWSDLIENKSALNVAPSHGLFAQAKENKNVSCFNP------MWARRYAEEIGVELR 173 R IEFWSD ++ + + S A + + + SC +P W Y +E+G L+ Sbjct: 252 RWIEFWSDAASDRRRRDSSSSEASTASSSSSSSSSCSSPPRRSTPRWVDNYLDELGSMLK 311 Query: 174 QAGWTDTEVAEML-------------SPPTPTAVRKVQGRENLMHELATSLRNAGWSAQD 314 + GW D EV EM+ P P + + + SLR AGW+++D Sbjct: 312 KGGWRDREVDEMVEVTASGFFDGEEAGAPAPDSEAILDALVLKTDRCSDSLRRAGWTSED 371 Query: 315 VMELFSVN 338 V + ++ Sbjct: 372 VSDALGLD 379 >XP_002991168.1 hypothetical protein SELMODRAFT_429511 [Selaginella moellendorffii] EFJ07712.1 hypothetical protein SELMODRAFT_429511 [Selaginella moellendorffii] Length = 524 Score = 55.5 bits (132), Expect = 6e-06 Identities = 40/129 (31%), Positives = 61/129 (47%), Gaps = 23/129 (17%) Frame = +3 Query: 6 GARRIEFWSDLIENKSALNVA----PSH--GLFAQAKEN----KNVSCFNPMWARRYAEE 155 G RRIEFWSDL+E ++N A SH GL E +N + E Sbjct: 359 GMRRIEFWSDLVEKGPSMNAAAGRSASHDDGLVQVGGETDLDWENAKSNPWQLVKESVGE 418 Query: 156 IGVELRQAGWTDTEVAEML----------SPPTPTAVRK---VQGRENLMHELATSLRNA 296 + ++LR+AGW + +VAE++ P P + ++G + L++ LR+A Sbjct: 419 MAIKLRRAGWNERDVAEIMDSCEQLDHRCDDPRPNPADRESVIEGLAAHLDFLSSCLRDA 478 Query: 297 GWSAQDVME 323 GWS D+ E Sbjct: 479 GWSIHDISE 487