BLASTX nr result
ID: Ephedra29_contig00027437
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00027437 (383 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010243450.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 3e-08 >XP_010243450.1 PREDICTED: pentatricopeptide repeat-containing protein At3g07290, mitochondrial [Nelumbo nucifera] XP_010243451.1 PREDICTED: pentatricopeptide repeat-containing protein At3g07290, mitochondrial [Nelumbo nucifera] XP_019051568.1 PREDICTED: pentatricopeptide repeat-containing protein At3g07290, mitochondrial [Nelumbo nucifera] XP_019051569.1 PREDICTED: pentatricopeptide repeat-containing protein At3g07290, mitochondrial [Nelumbo nucifera] XP_019051570.1 PREDICTED: pentatricopeptide repeat-containing protein At3g07290, mitochondrial [Nelumbo nucifera] Length = 900 Score = 60.8 bits (146), Expect = 3e-08 Identities = 35/109 (32%), Positives = 61/109 (55%), Gaps = 5/109 (4%) Frame = +1 Query: 64 HALASASSIHTSHLPSTKRDSTQSLEFWDTVHQICSLFSNP-----QRAEETIPRITPNH 228 HAL +S + +SH S+ T S T++QI L + P + + + +TP+ Sbjct: 17 HALLPSSML-SSHSLSSPAGGTNSDTVKSTIYQISHLINQPNWERNKYLKSLVSHLTPDV 75 Query: 229 FLKALEILGTTPEDGLEFFKWMDRIPSYSHNVESYLAIINILVSSNRFS 375 K +E+ G E G+ FFKW+ + +Y +++ES + ++N+LVSSN F+ Sbjct: 76 ASKVIELQGDDVERGVRFFKWVCKQSTYCYHLESRITLLNLLVSSNLFA 124