BLASTX nr result
ID: Ephedra29_contig00027275
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00027275 (248 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAV87786.1 DUF4219 domain-containing protein [Cephalotus follicu... 51 2e-06 >GAV87786.1 DUF4219 domain-containing protein [Cephalotus follicularis] Length = 99 Score = 51.2 bits (121), Expect = 2e-06 Identities = 21/59 (35%), Positives = 38/59 (64%) Frame = +3 Query: 66 PPIFDGNNFMQWKFRVEFYIKSLGGKCWDVIVNSIKSSKSELNDDDSNLESKKRLSEIK 242 PP FDGNNF +WK ++ +I+ + WDV+V+ K KS++ D+++ E + +++K Sbjct: 2 PPFFDGNNFNEWKIKMTSFIQCIDYDLWDVVVSDPKLPKSKVRYDENDRELLRLNAKVK 60