BLASTX nr result
ID: Ephedra29_contig00027156
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00027156 (315 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EYU35572.1 hypothetical protein MIMGU_mgv1a018815mg, partial [Er... 61 9e-09 XP_012839592.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 9e-09 XP_002453356.1 hypothetical protein SORBIDRAFT_04g004500 [Sorghu... 60 2e-08 EYU25273.1 hypothetical protein MIMGU_mgv1a024368mg, partial [Er... 60 2e-08 XP_012851881.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 2e-08 XP_011070702.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 2e-08 OEL34929.1 Pentatricopeptide repeat-containing protein [Dichanth... 60 2e-08 XP_004951798.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 2e-08 JAU18882.1 Pentatricopeptide repeat-containing protein, partial ... 56 3e-08 XP_002962075.1 hypothetical protein SELMODRAFT_77340 [Selaginell... 59 4e-08 XP_002971010.1 hypothetical protein SELMODRAFT_95046 [Selaginell... 59 4e-08 XP_004517144.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 4e-08 XP_004495472.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 4e-08 XP_004495469.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 4e-08 XP_004495476.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 4e-08 KCW89215.1 hypothetical protein EUGRSUZ_A01519 [Eucalyptus grandis] 59 4e-08 XP_010049643.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 4e-08 XP_003569969.2 PREDICTED: pentatricopeptide repeat-containing pr... 59 6e-08 KQJ93502.1 hypothetical protein BRADI_3g05000 [Brachypodium dist... 59 6e-08 XP_006648347.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 1e-07 >EYU35572.1 hypothetical protein MIMGU_mgv1a018815mg, partial [Erythranthe guttata] Length = 511 Score = 61.2 bits (147), Expect = 9e-09 Identities = 28/58 (48%), Positives = 37/58 (63%) Frame = +2 Query: 134 LSSEATYAELLDTCLHKGHLPQGRQIHSQILVRGLPLTAFLATKLVTMYHKCGSLNDA 307 +++E T L C H G L QGR +H I+ +GLPLT L T LV MY KCG++N+A Sbjct: 213 MANEVTMVSALCACAHLGALDQGRSMHRYIVEKGLPLTLILRTSLVDMYAKCGAINEA 270 >XP_012839592.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305 [Erythranthe guttata] Length = 518 Score = 61.2 bits (147), Expect = 9e-09 Identities = 28/58 (48%), Positives = 37/58 (63%) Frame = +2 Query: 134 LSSEATYAELLDTCLHKGHLPQGRQIHSQILVRGLPLTAFLATKLVTMYHKCGSLNDA 307 +++E T L C H G L QGR +H I+ +GLPLT L T LV MY KCG++N+A Sbjct: 220 MANEVTMVSALCACAHLGALDQGRSMHRYIVEKGLPLTLILRTSLVDMYAKCGAINEA 277 >XP_002453356.1 hypothetical protein SORBIDRAFT_04g004500 [Sorghum bicolor] EES06332.1 hypothetical protein SORBI_004G053100 [Sorghum bicolor] Length = 807 Score = 60.5 bits (145), Expect = 2e-08 Identities = 23/58 (39%), Positives = 41/58 (70%) Frame = +2 Query: 140 SEATYAELLDTCLHKGHLPQGRQIHSQILVRGLPLTAFLATKLVTMYHKCGSLNDARM 313 +E++YA ++++C +PQGRQIH+Q+L G ++ + L+ MY KCG+++DAR+ Sbjct: 518 TESSYASMINSCARLSSIPQGRQIHAQVLKDGYDQNVYVGSSLIDMYAKCGNMDDARL 575 >EYU25273.1 hypothetical protein MIMGU_mgv1a024368mg, partial [Erythranthe guttata] Length = 294 Score = 60.1 bits (144), Expect = 2e-08 Identities = 28/58 (48%), Positives = 36/58 (62%) Frame = +2 Query: 134 LSSEATYAELLDTCLHKGHLPQGRQIHSQILVRGLPLTAFLATKLVTMYHKCGSLNDA 307 +++E T L C H G L QG IH I+ +GLPLT L T LV MY KCG++N+A Sbjct: 202 MANEVTMVSALCACAHLGALDQGSSIHRYIVEKGLPLTLILRTSLVDMYAKCGAINEA 259 >XP_012851881.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305-like, partial [Erythranthe guttata] Length = 322 Score = 60.1 bits (144), Expect = 2e-08 Identities = 28/58 (48%), Positives = 36/58 (62%) Frame = +2 Query: 134 LSSEATYAELLDTCLHKGHLPQGRQIHSQILVRGLPLTAFLATKLVTMYHKCGSLNDA 307 +++E T L C H G L QG IH I+ +GLPLT L T LV MY KCG++N+A Sbjct: 231 MANEVTMVSALCACAHLGALDQGSSIHRYIVEKGLPLTLILRTSLVDMYAKCGAINEA 288 >XP_011070702.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305 [Sesamum indicum] Length = 541 Score = 60.1 bits (144), Expect = 2e-08 Identities = 29/58 (50%), Positives = 36/58 (62%) Frame = +2 Query: 134 LSSEATYAELLDTCLHKGHLPQGRQIHSQILVRGLPLTAFLATKLVTMYHKCGSLNDA 307 +++E T +L C H G L QGR IH IL GLPLT L T LV MY KCG++ +A Sbjct: 231 MANEVTMVSVLCACSHLGALEQGRVIHRHILENGLPLTLVLRTALVNMYAKCGAIQEA 288 >OEL34929.1 Pentatricopeptide repeat-containing protein [Dichanthelium oligosanthes] Length = 807 Score = 60.1 bits (144), Expect = 2e-08 Identities = 23/58 (39%), Positives = 41/58 (70%) Frame = +2 Query: 140 SEATYAELLDTCLHKGHLPQGRQIHSQILVRGLPLTAFLATKLVTMYHKCGSLNDARM 313 +E++YA ++++C +PQGRQIH+Q+L G ++ + L+ MY KCG+++DAR+ Sbjct: 518 TESSYASMINSCARLSSIPQGRQIHAQVLKDGYDQNVYVGSALIDMYAKCGNMDDARL 575 >XP_004951798.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20770-like [Setaria italica] KQL28593.1 hypothetical protein SETIT_019685mg [Setaria italica] Length = 807 Score = 60.1 bits (144), Expect = 2e-08 Identities = 23/58 (39%), Positives = 41/58 (70%) Frame = +2 Query: 140 SEATYAELLDTCLHKGHLPQGRQIHSQILVRGLPLTAFLATKLVTMYHKCGSLNDARM 313 +E++YA ++++C +PQGRQIH+Q+L G ++ + L+ MY KCG+++DAR+ Sbjct: 518 TESSYASMINSCARLSSIPQGRQIHAQVLKDGYEQNVYVGSALIDMYAKCGNMDDARL 575 >JAU18882.1 Pentatricopeptide repeat-containing protein, partial [Noccaea caerulescens] Length = 88 Score = 56.2 bits (134), Expect = 3e-08 Identities = 26/57 (45%), Positives = 35/57 (61%) Frame = +2 Query: 137 SSEATYAELLDTCLHKGHLPQGRQIHSQILVRGLPLTAFLATKLVTMYHKCGSLNDA 307 ++E T +L C H G L +G+++H IL LPLT L T L+ MY KCGS+ DA Sbjct: 29 ANEVTMVSVLCACAHLGALNRGKKLHRYILDEHLPLTVILQTSLIDMYAKCGSIGDA 85 >XP_002962075.1 hypothetical protein SELMODRAFT_77340 [Selaginella moellendorffii] EFJ37335.1 hypothetical protein SELMODRAFT_77340 [Selaginella moellendorffii] Length = 320 Score = 59.3 bits (142), Expect = 4e-08 Identities = 28/57 (49%), Positives = 35/57 (61%) Frame = +2 Query: 140 SEATYAELLDTCLHKGHLPQGRQIHSQILVRGLPLTAFLATKLVTMYHKCGSLNDAR 310 ++ T+ LD CL+ G L QGR +H+ I G+ L FL T LV MY KCGSL AR Sbjct: 91 NQITFVSALDACLNLGALQQGRAVHAAIATSGVELDCFLETALVNMYGKCGSLETAR 147 >XP_002971010.1 hypothetical protein SELMODRAFT_95046 [Selaginella moellendorffii] EFJ27608.1 hypothetical protein SELMODRAFT_95046 [Selaginella moellendorffii] Length = 320 Score = 59.3 bits (142), Expect = 4e-08 Identities = 28/57 (49%), Positives = 35/57 (61%) Frame = +2 Query: 140 SEATYAELLDTCLHKGHLPQGRQIHSQILVRGLPLTAFLATKLVTMYHKCGSLNDAR 310 ++ T+ LD CL+ G L QGR +H+ I G+ L FL T LV MY KCGSL AR Sbjct: 91 NQITFVSALDACLNLGALQQGRAVHAAIATSGVELDCFLETALVNMYGKCGSLETAR 147 >XP_004517144.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305-like, partial [Cicer arietinum] Length = 391 Score = 59.3 bits (142), Expect = 4e-08 Identities = 27/57 (47%), Positives = 35/57 (61%) Frame = +2 Query: 137 SSEATYAELLDTCLHKGHLPQGRQIHSQILVRGLPLTAFLATKLVTMYHKCGSLNDA 307 S+E T +L C H G L +GR +H I+ GLP+T L T LV MY KCG++ DA Sbjct: 174 SNEVTMVSVLSACAHLGALEKGRMMHKYIVNNGLPMTMVLQTSLVDMYAKCGAIEDA 230 >XP_004495472.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305-like isoform X2 [Cicer arietinum] Length = 445 Score = 59.3 bits (142), Expect = 4e-08 Identities = 27/57 (47%), Positives = 35/57 (61%) Frame = +2 Query: 137 SSEATYAELLDTCLHKGHLPQGRQIHSQILVRGLPLTAFLATKLVTMYHKCGSLNDA 307 S+E T +L C H G L +GR +H I+ GLP+T L T LV MY KCG++ DA Sbjct: 140 SNEVTMVSVLSACAHLGALEKGRMMHKYIVNNGLPMTMVLQTSLVDMYAKCGAIEDA 196 >XP_004495469.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305-like isoform X1 [Cicer arietinum] XP_004495470.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305-like isoform X1 [Cicer arietinum] XP_004495471.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305-like isoform X1 [Cicer arietinum] Length = 549 Score = 59.3 bits (142), Expect = 4e-08 Identities = 27/57 (47%), Positives = 35/57 (61%) Frame = +2 Query: 137 SSEATYAELLDTCLHKGHLPQGRQIHSQILVRGLPLTAFLATKLVTMYHKCGSLNDA 307 S+E T +L C H G L +GR +H I+ GLP+T L T LV MY KCG++ DA Sbjct: 244 SNEVTMVSVLSACAHLGALEKGRMMHKYIVNNGLPMTMVLQTSLVDMYAKCGAIEDA 300 >XP_004495476.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305-like [Cicer arietinum] Length = 557 Score = 59.3 bits (142), Expect = 4e-08 Identities = 27/57 (47%), Positives = 35/57 (61%) Frame = +2 Query: 137 SSEATYAELLDTCLHKGHLPQGRQIHSQILVRGLPLTAFLATKLVTMYHKCGSLNDA 307 S+E T +L C H G L +GR +H I+ GLP+T L T LV MY KCG++ DA Sbjct: 244 SNEVTMVSVLSACAHLGALEKGRMMHKYIVNNGLPMTMVLQTSLVDMYAKCGAIEDA 300 >KCW89215.1 hypothetical protein EUGRSUZ_A01519 [Eucalyptus grandis] Length = 584 Score = 59.3 bits (142), Expect = 4e-08 Identities = 26/55 (47%), Positives = 36/55 (65%) Frame = +2 Query: 149 TYAELLDTCLHKGHLPQGRQIHSQILVRGLPLTAFLATKLVTMYHKCGSLNDARM 313 T++ L+ TC+ L +G+QIH+ I + GL FL TKLV MY CGS+ DA+M Sbjct: 12 TFSSLIATCVRSKSLAEGKQIHAHIRINGLDSNEFLRTKLVNMYTSCGSIEDAKM 66 >XP_010049643.1 PREDICTED: pentatricopeptide repeat-containing protein At1g71460, chloroplastic [Eucalyptus grandis] Length = 684 Score = 59.3 bits (142), Expect = 4e-08 Identities = 26/55 (47%), Positives = 36/55 (65%) Frame = +2 Query: 149 TYAELLDTCLHKGHLPQGRQIHSQILVRGLPLTAFLATKLVTMYHKCGSLNDARM 313 T++ L+ TC+ L +G+QIH+ I + GL FL TKLV MY CGS+ DA+M Sbjct: 112 TFSSLIATCVRSKSLAEGKQIHAHIRINGLDSNEFLRTKLVNMYTSCGSIEDAKM 166 >XP_003569969.2 PREDICTED: pentatricopeptide repeat-containing protein At4g20770-like [Brachypodium distachyon] XP_014756510.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20770-like [Brachypodium distachyon] Length = 706 Score = 58.9 bits (141), Expect = 6e-08 Identities = 23/60 (38%), Positives = 42/60 (70%) Frame = +2 Query: 134 LSSEATYAELLDTCLHKGHLPQGRQIHSQILVRGLPLTAFLATKLVTMYHKCGSLNDARM 313 + +E++YA ++++C +PQGRQIH+QI+ G ++ + L+ MY KCG+++DAR+ Sbjct: 415 MPTESSYASMINSCARLSSVPQGRQIHAQIVKDGYDQNVYVGSALIDMYAKCGNMDDARV 474 >KQJ93502.1 hypothetical protein BRADI_3g05000 [Brachypodium distachyon] Length = 805 Score = 58.9 bits (141), Expect = 6e-08 Identities = 23/60 (38%), Positives = 42/60 (70%) Frame = +2 Query: 134 LSSEATYAELLDTCLHKGHLPQGRQIHSQILVRGLPLTAFLATKLVTMYHKCGSLNDARM 313 + +E++YA ++++C +PQGRQIH+QI+ G ++ + L+ MY KCG+++DAR+ Sbjct: 514 MPTESSYASMINSCARLSSVPQGRQIHAQIVKDGYDQNVYVGSALIDMYAKCGNMDDARV 573 >XP_006648347.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20770-like [Oryza brachyantha] Length = 668 Score = 58.2 bits (139), Expect = 1e-07 Identities = 22/60 (36%), Positives = 41/60 (68%) Frame = +2 Query: 134 LSSEATYAELLDTCLHKGHLPQGRQIHSQILVRGLPLTAFLATKLVTMYHKCGSLNDARM 313 + +E++YA ++++C +PQGRQIH+Q+L G ++ + L+ MY KCG+++DA + Sbjct: 377 MPTESSYASMVNSCARLSSIPQGRQIHAQVLKDGYDQNVYVGSALIDMYAKCGNMDDAHL 436