BLASTX nr result
ID: Ephedra29_contig00027148
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00027148 (305 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AET81969.1 hypothetical protein, partial [Pinus contorta var. bo... 117 3e-32 ABD60296.2 R2R3-MYB transcription factor MYB1, partial [Picea gl... 118 7e-32 ABK23245.1 unknown [Picea sitchensis] 118 4e-30 ABQ51217.1 R2R3-MYB transcription factor MYB1 [Picea glauca] 118 4e-30 ACA33839.1 R2R3-Myb1 transcription factor [Pinus pinaster] 117 1e-29 AAQ62541.1 R2R3-MYB transcription factor [Pinus taeda] 117 1e-29 ADF57329.1 R2R3 MYB transcription factor [Ginkgo biloba] 115 4e-29 ABP04051.1 R2R3MYB [Ginkgo biloba] 115 4e-29 XP_002960429.1 hypothetical protein SELMODRAFT_39499, partial [S... 108 6e-29 AFX98073.1 R2R3 transcription factor [Cunninghamia lanceolata] 112 4e-28 AFD36431.1 R2R3 MYB transcription factor [Ginkgo biloba] AFD3643... 111 2e-27 KGN50387.1 hypothetical protein Csa_5G171690 [Cucumis sativus] 102 3e-26 XP_010525304.2 PREDICTED: protein ODORANT1-like, partial [Tarena... 102 1e-25 EMS57450.1 Protein ODORANT1 [Triticum urartu] 102 1e-25 EEF30471.1 r2r3-myb transcription factor, putative [Ricinus comm... 100 1e-25 EMT17735.1 Protein ODORANT1 [Aegilops tauschii] 100 5e-25 XP_002452601.1 hypothetical protein SORBIDRAFT_04g028850 [Sorghu... 100 6e-25 AAL90633.1 A-type R2R3 Myb protein, partial [Sorghum bicolor] 98 6e-25 EMS60842.1 Protein ODORANT1 [Triticum urartu] 100 8e-25 XP_019455778.1 PREDICTED: protein ODORANT1-like [Lupinus angusti... 99 9e-25 >AET81969.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81970.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81971.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81972.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81973.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81974.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81975.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81976.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81977.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81978.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81979.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81980.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81981.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81982.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81983.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81984.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81985.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81986.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81987.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81988.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81989.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81990.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81991.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81992.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81993.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81994.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81995.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81996.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81997.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81998.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET81999.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET82000.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET82001.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET82002.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET82003.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET82004.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET82005.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET82006.1 hypothetical protein, partial [Pinus contorta var. bolanderi] AET82007.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82008.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82009.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82010.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82011.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82012.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82013.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82014.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82015.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82016.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82017.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82018.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82019.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82020.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82021.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82022.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82023.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82024.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82025.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82026.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82027.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82028.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82029.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82030.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82031.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82032.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82033.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82034.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82035.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82036.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82037.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82038.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82039.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82040.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82041.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82042.1 hypothetical protein, partial [Pinus contorta subsp. contorta] AET82043.1 hypothetical protein, partial [Pinus contorta var. murrayana] Length = 87 Score = 117 bits (292), Expect = 3e-32 Identities = 50/51 (98%), Positives = 51/51 (100%) Frame = +1 Query: 151 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 303 MGRQPCCDKVGLKKGPWTAEEDRKLVNFIT+HGHGCWREVPKLAGLLRCGK Sbjct: 1 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITLHGHGCWREVPKLAGLLRCGK 51 >ABD60296.2 R2R3-MYB transcription factor MYB1, partial [Picea glauca] Length = 154 Score = 118 bits (295), Expect = 7e-32 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = +1 Query: 151 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 303 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK Sbjct: 1 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 51 >ABK23245.1 unknown [Picea sitchensis] Length = 331 Score = 118 bits (295), Expect = 4e-30 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = +1 Query: 151 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 303 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK Sbjct: 1 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 51 >ABQ51217.1 R2R3-MYB transcription factor MYB1 [Picea glauca] Length = 332 Score = 118 bits (295), Expect = 4e-30 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = +1 Query: 151 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 303 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK Sbjct: 1 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 51 >ACA33839.1 R2R3-Myb1 transcription factor [Pinus pinaster] Length = 340 Score = 117 bits (292), Expect = 1e-29 Identities = 50/51 (98%), Positives = 51/51 (100%) Frame = +1 Query: 151 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 303 MGRQPCCDKVGLKKGPWTAEEDRKLVNFIT+HGHGCWREVPKLAGLLRCGK Sbjct: 1 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITLHGHGCWREVPKLAGLLRCGK 51 >AAQ62541.1 R2R3-MYB transcription factor [Pinus taeda] Length = 340 Score = 117 bits (292), Expect = 1e-29 Identities = 50/51 (98%), Positives = 51/51 (100%) Frame = +1 Query: 151 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 303 MGRQPCCDKVGLKKGPWTAEEDRKLVNFIT+HGHGCWREVPKLAGLLRCGK Sbjct: 1 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITLHGHGCWREVPKLAGLLRCGK 51 >ADF57329.1 R2R3 MYB transcription factor [Ginkgo biloba] Length = 346 Score = 115 bits (289), Expect = 4e-29 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = +1 Query: 151 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 303 MGRQPCCDKVGLKKGPWTAEEDRKLVNFIT HGHGCWREVPKLAGLLRCGK Sbjct: 1 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITTHGHGCWREVPKLAGLLRCGK 51 >ABP04051.1 R2R3MYB [Ginkgo biloba] Length = 346 Score = 115 bits (289), Expect = 4e-29 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = +1 Query: 151 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 303 MGRQPCCDKVGLKKGPWTAEEDRKLVNFIT HGHGCWREVPKLAGLLRCGK Sbjct: 1 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITTHGHGCWREVPKLAGLLRCGK 51 >XP_002960429.1 hypothetical protein SELMODRAFT_39499, partial [Selaginella moellendorffii] XP_002967288.1 hypothetical protein SELMODRAFT_39496, partial [Selaginella moellendorffii] EFJ31887.1 hypothetical protein SELMODRAFT_39496, partial [Selaginella moellendorffii] EFJ37968.1 hypothetical protein SELMODRAFT_39499, partial [Selaginella moellendorffii] Length = 87 Score = 108 bits (270), Expect = 6e-29 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +1 Query: 151 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 303 MGRQPCC+KVGLKKGPWTAEEDRKL+++IT HGHGCWR VPKLAGLLRCGK Sbjct: 1 MGRQPCCEKVGLKKGPWTAEEDRKLIHYITSHGHGCWRAVPKLAGLLRCGK 51 >AFX98073.1 R2R3 transcription factor [Cunninghamia lanceolata] Length = 303 Score = 112 bits (280), Expect = 4e-28 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +1 Query: 151 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 303 MGRQPCCDKVGLKKGPWT +EDRKLVNFI++HGHGCWREVPKLAGLLRCGK Sbjct: 1 MGRQPCCDKVGLKKGPWTTDEDRKLVNFISVHGHGCWREVPKLAGLLRCGK 51 >AFD36431.1 R2R3 MYB transcription factor [Ginkgo biloba] AFD36432.1 R2R3 MYB transcription factor [Ginkgo biloba] Length = 346 Score = 111 bits (277), Expect = 2e-27 Identities = 48/51 (94%), Positives = 48/51 (94%) Frame = +1 Query: 151 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 303 MGRQPCCDK GLKKGPWTAEEDRKLVNFIT HG GCWREVPKLAGLLRCGK Sbjct: 1 MGRQPCCDKAGLKKGPWTAEEDRKLVNFITTHGEGCWREVPKLAGLLRCGK 51 >KGN50387.1 hypothetical protein Csa_5G171690 [Cucumis sativus] Length = 108 Score = 102 bits (254), Expect = 3e-26 Identities = 47/80 (58%), Positives = 57/80 (71%) Frame = +1 Query: 64 IPELPIYSHSLYTIVERKNR*RRLYSISFMGRQPCCDKVGLKKGPWTAEEDRKLVNFITM 243 +P+ P + SLY ++E + MGRQPCCDK+G+KKGPWTAEED+KLV FI Sbjct: 1 MPQRPGWGGSLYILLE---------FVKVMGRQPCCDKLGVKKGPWTAEEDKKLVTFILT 51 Query: 244 HGHGCWREVPKLAGLLRCGK 303 +GH CWR VPKLAGL RCGK Sbjct: 52 YGHCCWRAVPKLAGLRRCGK 71 >XP_010525304.2 PREDICTED: protein ODORANT1-like, partial [Tarenaya hassleriana] Length = 144 Score = 102 bits (253), Expect = 1e-25 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +1 Query: 151 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 303 MGRQPCCDKVGLKKGPWT EED+KL+NFI +GH CWR VPKLAGLLRCGK Sbjct: 1 MGRQPCCDKVGLKKGPWTVEEDKKLINFILTNGHCCWRAVPKLAGLLRCGK 51 >EMS57450.1 Protein ODORANT1 [Triticum urartu] Length = 173 Score = 102 bits (255), Expect = 1e-25 Identities = 44/51 (86%), Positives = 46/51 (90%) Frame = +1 Query: 151 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 303 MGRQPCCDKVGLKKGPWTAEED+KLV F+ HGH CWR VPKLAGLLRCGK Sbjct: 1 MGRQPCCDKVGLKKGPWTAEEDQKLVGFLLTHGHYCWRVVPKLAGLLRCGK 51 >EEF30471.1 r2r3-myb transcription factor, putative [Ricinus communis] Length = 98 Score = 100 bits (249), Expect = 1e-25 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +1 Query: 151 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 303 MGRQPCCDKVGLKKGPWTAEED+KL+NFI +G CWR VPKLAGLLRCGK Sbjct: 1 MGRQPCCDKVGLKKGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGK 51 >EMT17735.1 Protein ODORANT1 [Aegilops tauschii] Length = 137 Score = 100 bits (248), Expect = 5e-25 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +1 Query: 151 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 303 MGRQPCC+KVGLKKGPWTAEED+KLV F+ HGH CWR VPKLAGLLRCGK Sbjct: 1 MGRQPCCEKVGLKKGPWTAEEDQKLVAFLLSHGHCCWRLVPKLAGLLRCGK 51 >XP_002452601.1 hypothetical protein SORBIDRAFT_04g028850 [Sorghum bicolor] Length = 164 Score = 100 bits (250), Expect = 6e-25 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +1 Query: 151 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 303 MGRQPCC+KVGLKKGPWTAEED+KLV F+ HGH CWR VPKLAGLLRCGK Sbjct: 1 MGRQPCCEKVGLKKGPWTAEEDQKLVTFLLSHGHCCWRLVPKLAGLLRCGK 51 >AAL90633.1 A-type R2R3 Myb protein, partial [Sorghum bicolor] Length = 64 Score = 97.8 bits (242), Expect = 6e-25 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +1 Query: 151 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 303 MGRQPCCDKVGLKKGPWTAEED+KLV+FI +G CWR VPKLAGLLRCGK Sbjct: 1 MGRQPCCDKVGLKKGPWTAEEDQKLVSFILGNGQCCWRAVPKLAGLLRCGK 51 >EMS60842.1 Protein ODORANT1 [Triticum urartu] Length = 152 Score = 100 bits (248), Expect = 8e-25 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +1 Query: 151 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 303 MGRQPCC+KVGLKKGPWTAEED+KLV F+ HGH CWR VPKLAGLLRCGK Sbjct: 1 MGRQPCCEKVGLKKGPWTAEEDQKLVAFLLSHGHCCWRLVPKLAGLLRCGK 51 >XP_019455778.1 PREDICTED: protein ODORANT1-like [Lupinus angustifolius] Length = 104 Score = 98.6 bits (244), Expect = 9e-25 Identities = 42/51 (82%), Positives = 45/51 (88%) Frame = +1 Query: 151 MGRQPCCDKVGLKKGPWTAEEDRKLVNFITMHGHGCWREVPKLAGLLRCGK 303 MGRQPCCDKVGLKKGPWTA+ED KL+NFI +G CWR VPKLAGLLRCGK Sbjct: 1 MGRQPCCDKVGLKKGPWTADEDNKLINFILTNGQCCWRAVPKLAGLLRCGK 51