BLASTX nr result
ID: Ephedra29_contig00026955
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00026955 (257 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018855274.1 PREDICTED: BTB/POZ domain-containing protein At1g... 109 2e-28 XP_015076573.1 PREDICTED: BTB/POZ domain-containing protein At1g... 114 8e-28 XP_004239131.1 PREDICTED: BTB/POZ domain-containing protein At1g... 114 8e-28 XP_011071147.1 PREDICTED: BTB/POZ domain-containing protein At1g... 114 9e-28 KZV14918.1 BTB/POZ domain-containing protein [Dorcoceras hygrome... 112 3e-27 XP_008221906.1 PREDICTED: BTB/POZ domain-containing protein At1g... 112 3e-27 XP_007221979.1 hypothetical protein PRUPE_ppa002809mg [Prunus pe... 112 3e-27 XP_019225885.1 PREDICTED: BTB/POZ domain-containing protein At1g... 112 4e-27 XP_004299219.1 PREDICTED: BTB/POZ domain-containing protein At1g... 112 6e-27 XP_014523987.1 PREDICTED: BTB/POZ domain-containing protein At1g... 112 6e-27 XP_017231338.1 PREDICTED: BTB/POZ domain-containing protein At1g... 111 8e-27 XP_002311763.1 phototropic-responsive NPH3 family protein [Popul... 111 8e-27 XP_002530034.1 PREDICTED: BTB/POZ domain-containing protein At1g... 111 8e-27 XP_016509067.1 PREDICTED: BTB/POZ domain-containing protein At1g... 111 1e-26 XP_009614413.1 PREDICTED: BTB/POZ domain-containing protein At1g... 111 1e-26 XP_006357600.1 PREDICTED: BTB/POZ domain-containing protein At1g... 111 1e-26 XP_007153783.1 hypothetical protein PHAVU_003G064600g [Phaseolus... 111 1e-26 KDO82222.1 hypothetical protein CISIN_1g006846mg [Citrus sinensis] 110 1e-26 XP_018837403.1 PREDICTED: BTB/POZ domain-containing protein At5g... 110 1e-26 XP_009770852.1 PREDICTED: BTB/POZ domain-containing protein At1g... 110 1e-26 >XP_018855274.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like, partial [Juglans regia] Length = 180 Score = 109 bits (272), Expect = 2e-28 Identities = 54/86 (62%), Positives = 65/86 (75%), Gaps = 1/86 (1%) Frame = +2 Query: 2 DIVILVKDTKFLLHKFPLLSKCGRLQVLASEIRQPKDYSF-ELHDIPGGVEAFEICAKFC 178 D++I VK +++LLHKFPLLSKC RLQ + SE + + +L D PGGVEAFE+CAKFC Sbjct: 29 DLIIQVKGSRYLLHKFPLLSKCLRLQRMCSESPESSQHQIVQLPDFPGGVEAFELCAKFC 88 Query: 179 YGIKITISALNIVLVRCAAEYLLMNE 256 YGI IT+SA NIV RCAAEYL M E Sbjct: 89 YGITITLSAYNIVSARCAAEYLQMTE 114 >XP_015076573.1 PREDICTED: BTB/POZ domain-containing protein At1g67900 isoform X1 [Solanum pennellii] Length = 608 Score = 114 bits (285), Expect = 8e-28 Identities = 55/86 (63%), Positives = 66/86 (76%), Gaps = 1/86 (1%) Frame = +2 Query: 2 DIVILVKDTKFLLHKFPLLSKCGRLQVLASEIRQPKDYSF-ELHDIPGGVEAFEICAKFC 178 D+++ VK +++LLHKFPLLSKC RLQ L SEI + + +L D PGG+EAFEICAKFC Sbjct: 29 DLIVQVKGSRYLLHKFPLLSKCSRLQRLCSEIPETSQHQIVQLPDFPGGIEAFEICAKFC 88 Query: 179 YGIKITISALNIVLVRCAAEYLLMNE 256 YGI IT+SA NIV RCAAEYL M E Sbjct: 89 YGITITLSAYNIVAARCAAEYLQMTE 114 >XP_004239131.1 PREDICTED: BTB/POZ domain-containing protein At1g67900 [Solanum lycopersicum] Length = 610 Score = 114 bits (285), Expect = 8e-28 Identities = 55/86 (63%), Positives = 66/86 (76%), Gaps = 1/86 (1%) Frame = +2 Query: 2 DIVILVKDTKFLLHKFPLLSKCGRLQVLASEIRQPKDYSF-ELHDIPGGVEAFEICAKFC 178 D+++ VK +++LLHKFPLLSKC RLQ L SEI + + +L D PGG+EAFEICAKFC Sbjct: 29 DLIVQVKGSRYLLHKFPLLSKCSRLQRLCSEIPETSQHQIVQLPDFPGGIEAFEICAKFC 88 Query: 179 YGIKITISALNIVLVRCAAEYLLMNE 256 YGI IT+SA NIV RCAAEYL M E Sbjct: 89 YGITITLSAYNIVAARCAAEYLQMTE 114 >XP_011071147.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Sesamum indicum] XP_011071148.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Sesamum indicum] XP_011071149.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Sesamum indicum] Length = 619 Score = 114 bits (285), Expect = 9e-28 Identities = 56/86 (65%), Positives = 66/86 (76%), Gaps = 1/86 (1%) Frame = +2 Query: 2 DIVILVKDTKFLLHKFPLLSKCGRLQVLASEIRQPKDYSF-ELHDIPGGVEAFEICAKFC 178 D++I VK +++LLHKFPLLSKC RLQ L SE + +LHD PGGVEAFE+CAKFC Sbjct: 29 DLIIQVKGSRYLLHKFPLLSKCLRLQKLCSETSESSQPQLVQLHDFPGGVEAFELCAKFC 88 Query: 179 YGIKITISALNIVLVRCAAEYLLMNE 256 YGI IT+SA NIV +RCAAEYL M E Sbjct: 89 YGITITLSAYNIVSIRCAAEYLQMTE 114 >KZV14918.1 BTB/POZ domain-containing protein [Dorcoceras hygrometricum] Length = 629 Score = 112 bits (281), Expect = 3e-27 Identities = 57/86 (66%), Positives = 65/86 (75%), Gaps = 1/86 (1%) Frame = +2 Query: 2 DIVILVKDTKFLLHKFPLLSKCGRLQVLASEIRQPKDYSF-ELHDIPGGVEAFEICAKFC 178 D++I VK +++LLHKFPLLSKC RLQ L +E + LHD PGGVEAFEICAKFC Sbjct: 29 DLIIQVKGSRYLLHKFPLLSKCLRLQRLCAENSEASQIQIIHLHDYPGGVEAFEICAKFC 88 Query: 179 YGIKITISALNIVLVRCAAEYLLMNE 256 YGI IT+SA NIV VRCAAEYL M E Sbjct: 89 YGITITLSAYNIVSVRCAAEYLQMTE 114 >XP_008221906.1 PREDICTED: BTB/POZ domain-containing protein At1g67900 [Prunus mume] Length = 631 Score = 112 bits (281), Expect = 3e-27 Identities = 55/86 (63%), Positives = 66/86 (76%), Gaps = 1/86 (1%) Frame = +2 Query: 2 DIVILVKDTKFLLHKFPLLSKCGRLQVLASEIRQPKDYSF-ELHDIPGGVEAFEICAKFC 178 D++I VK +++LLHKFPLLSKC RLQ L SE ++ + +LHD P GVEAFE+CAKFC Sbjct: 29 DLIIQVKGSRYLLHKFPLLSKCLRLQRLCSEYQEASQHQIIQLHDFPSGVEAFELCAKFC 88 Query: 179 YGIKITISALNIVLVRCAAEYLLMNE 256 YGI IT+SA NIV RCAAEYL M E Sbjct: 89 YGITITLSAYNIVASRCAAEYLQMTE 114 >XP_007221979.1 hypothetical protein PRUPE_ppa002809mg [Prunus persica] ONI30341.1 hypothetical protein PRUPE_1G245700 [Prunus persica] Length = 631 Score = 112 bits (281), Expect = 3e-27 Identities = 55/86 (63%), Positives = 66/86 (76%), Gaps = 1/86 (1%) Frame = +2 Query: 2 DIVILVKDTKFLLHKFPLLSKCGRLQVLASEIRQPKDYSF-ELHDIPGGVEAFEICAKFC 178 D++I VK +++LLHKFPLLSKC RLQ L SE ++ + +LHD P GVEAFE+CAKFC Sbjct: 29 DLIIQVKGSRYLLHKFPLLSKCLRLQRLCSEYQEASQHQIIQLHDFPSGVEAFELCAKFC 88 Query: 179 YGIKITISALNIVLVRCAAEYLLMNE 256 YGI IT+SA NIV RCAAEYL M E Sbjct: 89 YGITITLSAYNIVASRCAAEYLQMTE 114 >XP_019225885.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Nicotiana attenuata] OIT32377.1 btbpoz domain-containing protein [Nicotiana attenuata] Length = 614 Score = 112 bits (280), Expect = 4e-27 Identities = 54/86 (62%), Positives = 65/86 (75%), Gaps = 1/86 (1%) Frame = +2 Query: 2 DIVILVKDTKFLLHKFPLLSKCGRLQVLASEIRQPKDYSF-ELHDIPGGVEAFEICAKFC 178 D+++ VK +++LLHKFPLLSKC RLQ L SE + + +L D PGG+EAFE+CAKFC Sbjct: 29 DLIVQVKGSRYLLHKFPLLSKCSRLQKLCSESPETSQHQIVQLPDFPGGIEAFELCAKFC 88 Query: 179 YGIKITISALNIVLVRCAAEYLLMNE 256 YGI ITISA NIV RCAAEYL M E Sbjct: 89 YGITITISAYNIVAARCAAEYLQMTE 114 >XP_004299219.1 PREDICTED: BTB/POZ domain-containing protein At1g67900 [Fragaria vesca subsp. vesca] Length = 631 Score = 112 bits (279), Expect = 6e-27 Identities = 55/86 (63%), Positives = 65/86 (75%), Gaps = 1/86 (1%) Frame = +2 Query: 2 DIVILVKDTKFLLHKFPLLSKCGRLQVLASEIRQPKDYSF-ELHDIPGGVEAFEICAKFC 178 D++I VK +++LLHKFPLLSKC RLQ L SE + + +LHD P GVEAFE+CAKFC Sbjct: 29 DLIIQVKGSRYLLHKFPLLSKCLRLQRLCSEYAESSQHQIIQLHDFPSGVEAFELCAKFC 88 Query: 179 YGIKITISALNIVLVRCAAEYLLMNE 256 YGI IT+SA NIV RCAAEYL M E Sbjct: 89 YGITITLSAHNIVAARCAAEYLQMTE 114 >XP_014523987.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Vigna radiata var. radiata] Length = 632 Score = 112 bits (279), Expect = 6e-27 Identities = 57/86 (66%), Positives = 65/86 (75%), Gaps = 1/86 (1%) Frame = +2 Query: 2 DIVILVKDTKFLLHKFPLLSKCGRLQVLASEIRQ-PKDYSFELHDIPGGVEAFEICAKFC 178 DI+I VK T++LLHKFPLLSKC RLQ L SE P+ +L + PGGVEAFE+CAKFC Sbjct: 29 DIIIQVKGTRYLLHKFPLLSKCSRLQRLCSESSDSPQHQIVQLPEFPGGVEAFELCAKFC 88 Query: 179 YGIKITISALNIVLVRCAAEYLLMNE 256 YGI IT+SA NIV RCAAEYL M E Sbjct: 89 YGITITLSAYNIVSSRCAAEYLQMTE 114 >XP_017231338.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Daucus carota subsp. sativus] XP_017231339.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Daucus carota subsp. sativus] KZN06216.1 hypothetical protein DCAR_007053 [Daucus carota subsp. sativus] Length = 628 Score = 111 bits (278), Expect = 8e-27 Identities = 56/86 (65%), Positives = 65/86 (75%), Gaps = 1/86 (1%) Frame = +2 Query: 2 DIVILVKDTKFLLHKFPLLSKCGRLQVLASEIRQPKDYSF-ELHDIPGGVEAFEICAKFC 178 DI+I VK T+++LHKFPLLSKC RLQ L E + + +L D PGG+EAFEICAKFC Sbjct: 29 DIMIQVKGTRYMLHKFPLLSKCLRLQRLCYETPESSQHQIIQLPDFPGGIEAFEICAKFC 88 Query: 179 YGIKITISALNIVLVRCAAEYLLMNE 256 YGI IT+SA NIV RCAAEYL MNE Sbjct: 89 YGITITLSAYNIVSARCAAEYLQMNE 114 >XP_002311763.1 phototropic-responsive NPH3 family protein [Populus trichocarpa] EEE89130.1 phototropic-responsive NPH3 family protein [Populus trichocarpa] Length = 628 Score = 111 bits (278), Expect = 8e-27 Identities = 55/86 (63%), Positives = 66/86 (76%), Gaps = 1/86 (1%) Frame = +2 Query: 2 DIVILVKDTKFLLHKFPLLSKCGRLQVLASEIRQPKDYSF-ELHDIPGGVEAFEICAKFC 178 D+++ VK +++LLHKFPLLSKC RLQ L SE + + +L D PGGVEAFE+CAKFC Sbjct: 29 DLIVQVKGSRYLLHKFPLLSKCLRLQRLCSESPETSQHHIVQLPDFPGGVEAFELCAKFC 88 Query: 179 YGIKITISALNIVLVRCAAEYLLMNE 256 YGI IT+SA NIV VRCAAEYL M E Sbjct: 89 YGITITLSAFNIVAVRCAAEYLQMTE 114 >XP_002530034.1 PREDICTED: BTB/POZ domain-containing protein At1g67900 [Ricinus communis] EEF32334.1 signal transducer, putative [Ricinus communis] Length = 631 Score = 111 bits (278), Expect = 8e-27 Identities = 55/86 (63%), Positives = 66/86 (76%), Gaps = 1/86 (1%) Frame = +2 Query: 2 DIVILVKDTKFLLHKFPLLSKCGRLQVLASEIRQPKDYSF-ELHDIPGGVEAFEICAKFC 178 D++I VK +++LLHKFPLLSKC RLQ L SE + + +L D PGG+EAFE+CAKFC Sbjct: 29 DLIIQVKGSRYLLHKFPLLSKCLRLQRLCSESPESSQHQIVQLPDFPGGIEAFELCAKFC 88 Query: 179 YGIKITISALNIVLVRCAAEYLLMNE 256 YGI IT+SA NIV VRCAAEYL M E Sbjct: 89 YGITITLSAYNIVAVRCAAEYLQMTE 114 >XP_016509067.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Nicotiana tabacum] Length = 617 Score = 111 bits (277), Expect = 1e-26 Identities = 53/86 (61%), Positives = 65/86 (75%), Gaps = 1/86 (1%) Frame = +2 Query: 2 DIVILVKDTKFLLHKFPLLSKCGRLQVLASEIRQPKDYSF-ELHDIPGGVEAFEICAKFC 178 D+++ VK +++LLHKFPLLSKC RLQ L SE + + +L D PGG+EAFE+CAKFC Sbjct: 29 DLIVQVKGSRYLLHKFPLLSKCSRLQKLCSESPETSHHQIVQLPDFPGGIEAFELCAKFC 88 Query: 179 YGIKITISALNIVLVRCAAEYLLMNE 256 YGI IT+SA NIV RCAAEYL M E Sbjct: 89 YGITITLSAYNIVAARCAAEYLQMTE 114 >XP_009614413.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Nicotiana tomentosiformis] Length = 617 Score = 111 bits (277), Expect = 1e-26 Identities = 53/86 (61%), Positives = 65/86 (75%), Gaps = 1/86 (1%) Frame = +2 Query: 2 DIVILVKDTKFLLHKFPLLSKCGRLQVLASEIRQPKDYSF-ELHDIPGGVEAFEICAKFC 178 D+++ VK +++LLHKFPLLSKC RLQ L SE + + +L D PGG+EAFE+CAKFC Sbjct: 29 DLIVQVKGSRYLLHKFPLLSKCSRLQKLCSESPETSHHQIVQLPDFPGGIEAFELCAKFC 88 Query: 179 YGIKITISALNIVLVRCAAEYLLMNE 256 YGI IT+SA NIV RCAAEYL M E Sbjct: 89 YGITITLSAYNIVAARCAAEYLQMTE 114 >XP_006357600.1 PREDICTED: BTB/POZ domain-containing protein At1g67900 [Solanum tuberosum] Length = 628 Score = 111 bits (277), Expect = 1e-26 Identities = 53/86 (61%), Positives = 65/86 (75%), Gaps = 1/86 (1%) Frame = +2 Query: 2 DIVILVKDTKFLLHKFPLLSKCGRLQVLASEIRQPKDYSF-ELHDIPGGVEAFEICAKFC 178 D+++ VK +++LLHKFPLLSKC RLQ L SE + + +L D PGG+EAFE+CAKFC Sbjct: 29 DLIVQVKGSRYLLHKFPLLSKCSRLQRLCSESPETSQHQIVQLPDFPGGIEAFELCAKFC 88 Query: 179 YGIKITISALNIVLVRCAAEYLLMNE 256 YGI IT+SA NIV RCAAEYL M E Sbjct: 89 YGITITLSAYNIVAARCAAEYLQMTE 114 >XP_007153783.1 hypothetical protein PHAVU_003G064600g [Phaseolus vulgaris] ESW25777.1 hypothetical protein PHAVU_003G064600g [Phaseolus vulgaris] Length = 632 Score = 111 bits (277), Expect = 1e-26 Identities = 56/86 (65%), Positives = 65/86 (75%), Gaps = 1/86 (1%) Frame = +2 Query: 2 DIVILVKDTKFLLHKFPLLSKCGRLQVLASEIRQ-PKDYSFELHDIPGGVEAFEICAKFC 178 D++I VK T++LLHKFPLLSKC RLQ L SE P+ +L + PGGVEAFE+CAKFC Sbjct: 29 DLIIQVKGTRYLLHKFPLLSKCLRLQRLCSESSDSPQQQIVQLPEFPGGVEAFELCAKFC 88 Query: 179 YGIKITISALNIVLVRCAAEYLLMNE 256 YGI IT+SA NIV RCAAEYL M E Sbjct: 89 YGITITLSAYNIVTARCAAEYLQMTE 114 >KDO82222.1 hypothetical protein CISIN_1g006846mg [Citrus sinensis] Length = 478 Score = 110 bits (275), Expect = 1e-26 Identities = 54/86 (62%), Positives = 65/86 (75%), Gaps = 1/86 (1%) Frame = +2 Query: 2 DIVILVKDTKFLLHKFPLLSKCGRLQVLASEIRQPKDYSF-ELHDIPGGVEAFEICAKFC 178 D++I VK T++LLHKFPLLSKC RLQ L SE + + +L D PGG++AFE+CAKFC Sbjct: 29 DLIIQVKGTRYLLHKFPLLSKCLRLQRLCSESPESSQHQIVQLPDFPGGIDAFELCAKFC 88 Query: 179 YGIKITISALNIVLVRCAAEYLLMNE 256 YGI IT+SA NIV RCAAEYL M E Sbjct: 89 YGITITLSAYNIVAARCAAEYLQMTE 114 >XP_018837403.1 PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X2 [Juglans regia] Length = 598 Score = 110 bits (276), Expect = 1e-26 Identities = 53/85 (62%), Positives = 62/85 (72%) Frame = +2 Query: 2 DIVILVKDTKFLLHKFPLLSKCGRLQVLASEIRQPKDYSFELHDIPGGVEAFEICAKFCY 181 DIVI + DT +LLHKFPLL KCG LQ L SE + + ELHD+PGG EAFE+CAKFCY Sbjct: 29 DIVIQINDTSYLLHKFPLLPKCGLLQRLCSEAGDSNNVTVELHDLPGGEEAFELCAKFCY 88 Query: 182 GIKITISALNIVLVRCAAEYLLMNE 256 GI I +SA N V CAA++L MNE Sbjct: 89 GITINVSARNFVPAFCAAKFLRMNE 113 >XP_009770852.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Nicotiana sylvestris] XP_016465030.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Nicotiana tabacum] Length = 616 Score = 110 bits (276), Expect = 1e-26 Identities = 53/86 (61%), Positives = 65/86 (75%), Gaps = 1/86 (1%) Frame = +2 Query: 2 DIVILVKDTKFLLHKFPLLSKCGRLQVLASEIRQPKDYSF-ELHDIPGGVEAFEICAKFC 178 D+++ VK +++LLHKFPLLSKC RLQ L SE + + +L D PGG+EAFE+CAKFC Sbjct: 29 DLLVQVKGSRYLLHKFPLLSKCSRLQKLCSESPETSQHQIVQLPDFPGGIEAFELCAKFC 88 Query: 179 YGIKITISALNIVLVRCAAEYLLMNE 256 YGI IT+SA NIV RCAAEYL M E Sbjct: 89 YGITITLSAYNIVAARCAAEYLQMTE 114