BLASTX nr result
ID: Ephedra29_contig00026726
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00026726 (449 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010030793.2 PREDICTED: protein LONGIFOLIA 1 [Eucalyptus grand... 57 9e-07 >XP_010030793.2 PREDICTED: protein LONGIFOLIA 1 [Eucalyptus grandis] XP_018723240.1 PREDICTED: protein LONGIFOLIA 1 [Eucalyptus grandis] XP_018723241.1 PREDICTED: protein LONGIFOLIA 1 [Eucalyptus grandis] XP_018723242.1 PREDICTED: protein LONGIFOLIA 1 [Eucalyptus grandis] KCW83738.1 hypothetical protein EUGRSUZ_B00609 [Eucalyptus grandis] Length = 1101 Score = 57.4 bits (137), Expect = 9e-07 Identities = 48/151 (31%), Positives = 74/151 (49%), Gaps = 5/151 (3%) Frame = -3 Query: 444 GNPNSRAFDAPIVLIKPAKMAT--GSSHLSQNPKRTSLTSHQTVSNI-KRASMISQKTTK 274 G+ +SR+F++PIV++KPAK+ G + S P T + H+ SN R S + K Sbjct: 539 GSESSRSFESPIVIMKPAKLVEKHGFNASSMIPLDTLSSLHKIQSNADSRNYPTSSRPAK 598 Query: 273 D--HQSGRMSSSSEASPAKHHRRELSSNNKLRSEIGLVEQRGRCSISPPSSPSLRNPQTG 100 D ++GR+ S+S ++ K R S + S P S NP + Sbjct: 599 DPSRKTGRLESTSSSADKKASGRNTKSTR---------------TSSRPQQVSKENPAS- 642 Query: 99 IPSVKVNSPTSPGKLQRNKLDMERKSRQSSP 7 S K + SP +LQ+ KLD+ER+SR +P Sbjct: 643 --SAKSSGSVSP-RLQQKKLDLERRSRPPTP 670