BLASTX nr result
ID: Ephedra29_contig00026650
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00026650 (352 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KMZ73318.1 Pleiotropic drug resistance protein 12 [Zostera marina] 54 5e-06 XP_010654625.1 PREDICTED: ABC transporter G family member 29 [Vi... 53 1e-05 >KMZ73318.1 Pleiotropic drug resistance protein 12 [Zostera marina] Length = 1497 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 5/44 (11%) Frame = +3 Query: 234 DDIFGKS-----ASTVSQRQRLNEDEEALRWAAIERLPTYDRVR 350 DD+F S S +S+R R++EDEEALRWAA+E+LPTYDR+R Sbjct: 32 DDVFSLSNSVSRRSNMSRRGRVDEDEEALRWAALEKLPTYDRLR 75 >XP_010654625.1 PREDICTED: ABC transporter G family member 29 [Vitis vinifera] CBI36070.3 unnamed protein product, partial [Vitis vinifera] Length = 1493 Score = 53.1 bits (126), Expect = 1e-05 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = +3 Query: 234 DDIFGKSASTVSQRQRLNEDEEALRWAAIERLPTYDRVR 350 +D+F SAS S+R L++DEEALRWAA+E+LPTYDR+R Sbjct: 24 EDVF--SASRRSRRSNLDDDEEALRWAALEKLPTYDRLR 60