BLASTX nr result
ID: Ephedra29_contig00026605
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00026605 (304 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CEM24691.1 unnamed protein product [Vitrella brassicaformis CCMP... 76 6e-14 XP_001775171.1 predicted protein [Physcomitrella patens] EDQ6003... 67 8e-11 OLQ06042.1 Ubiquitin-conjugating enzyme E2 Q2 [Symbiodinium micr... 64 1e-09 KOO53575.1 ubiquitinconjugating enzyme subfamily protein [Chryso... 62 6e-09 GAQ84192.1 protein with ubiquitin conjugating enzyme domain [Kle... 61 8e-09 BAK02238.1 predicted protein [Hordeum vulgare subsp. vulgare] 58 9e-08 XP_005778232.1 hypothetical protein EMIHUDRAFT_354118 [Emiliania... 58 1e-07 XP_014538829.1 Ubiquitin conjugating enzyme, putative [Penicilli... 58 1e-07 KXG45753.1 Ubiquitin-conjugating enzyme, E2 [Penicillium griseof... 57 2e-07 KXX82047.1 Ubiquitin-conjugating enzyme E2 Q2 [Madurella mycetom... 57 2e-07 OJJ62458.1 hypothetical protein ASPSYDRAFT_41126 [Aspergillus sy... 57 3e-07 KUM59181.1 hypothetical protein ACN42_g7968 [Penicillium freii] 57 3e-07 XP_004340442.1 Ubiquitinconjugating enzyme subfamily protein [Ac... 56 3e-07 XP_016599188.1 Ubiquitin-conjugating enzyme, E2 [Penicillium exp... 57 4e-07 EDP50745.1 ubiquitin conjugating enzyme, putative [Aspergillus f... 57 4e-07 KEY81511.1 ubiquitin conjugating enzyme [Aspergillus fumigatus v... 57 4e-07 XP_005761313.1 hypothetical protein EMIHUDRAFT_317118 [Emiliania... 56 5e-07 XP_005768000.1 hypothetical protein EMIHUDRAFT_459287 [Emiliania... 56 6e-07 XP_005792402.1 hypothetical protein EMIHUDRAFT_466615 [Emiliania... 56 6e-07 XP_004342069.1 Ubiquitinconjugating enzyme subfamily protein [Ac... 55 8e-07 >CEM24691.1 unnamed protein product [Vitrella brassicaformis CCMP3155] Length = 1350 Score = 75.9 bits (185), Expect = 6e-14 Identities = 32/60 (53%), Positives = 44/60 (73%) Frame = +2 Query: 2 MELLTPAGWTPAFNLEAVLVQIHNAILEGGGRLDLADHSDYSYGEAIVAFDRAARVHNWI 181 MELLTP+GW P +++E+VL+QI + ++EGGGR+D DY+ EA A+DR AR H WI Sbjct: 1290 MELLTPSGWRPTYSIESVLIQIKSEVIEGGGRIDFNHCGDYTDAEARAAYDRVARQHGWI 1349 >XP_001775171.1 predicted protein [Physcomitrella patens] EDQ60032.1 predicted protein [Physcomitrella patens] Length = 1110 Score = 67.0 bits (162), Expect = 8e-11 Identities = 33/59 (55%), Positives = 40/59 (67%) Frame = +2 Query: 2 MELLTPAGWTPAFNLEAVLVQIHNAILEGGGRLDLADHSDYSYGEAIVAFDRAARVHNW 178 MELLT +GW+PA N E++LVQ+ A LEG GRLD+ +Y EA AF RAAR H W Sbjct: 1049 MELLTASGWSPACNFESLLVQVVMAFLEGEGRLDMKVRQEYQESEAREAFLRAARSHGW 1107 >OLQ06042.1 Ubiquitin-conjugating enzyme E2 Q2 [Symbiodinium microadriaticum] Length = 711 Score = 63.5 bits (153), Expect = 1e-09 Identities = 30/60 (50%), Positives = 40/60 (66%) Frame = +2 Query: 2 MELLTPAGWTPAFNLEAVLVQIHNAILEGGGRLDLADHSDYSYGEAIVAFDRAARVHNWI 181 M+LLTP+GW P +LE V V I + ++EGGGRLD + DYS EA AF R A+ + W+ Sbjct: 650 MQLLTPSGWLPTVSLENVFVAIRSEMVEGGGRLDFSCTRDYSAQEAREAFQRVAQRYGWL 709 >KOO53575.1 ubiquitinconjugating enzyme subfamily protein [Chrysochromulina sp. CCMP291] Length = 598 Score = 61.6 bits (148), Expect = 6e-09 Identities = 29/58 (50%), Positives = 36/58 (62%) Frame = +2 Query: 5 ELLTPAGWTPAFNLEAVLVQIHNAILEGGGRLDLADHSDYSYGEAIVAFDRAARVHNW 178 E+LT AGW P +E+ L+ I +L GG RLDL+ SDYS EA AF+R R H W Sbjct: 540 EMLTSAGWQPTMTIESALLSIRTNMLVGGARLDLSQRSDYSELEAREAFNRMVREHGW 597 >GAQ84192.1 protein with ubiquitin conjugating enzyme domain [Klebsormidium flaccidum] Length = 1078 Score = 61.2 bits (147), Expect = 8e-09 Identities = 33/62 (53%), Positives = 39/62 (62%), Gaps = 3/62 (4%) Frame = +2 Query: 2 MELLTPAGWTPAFNLEAVLVQIHNAILEGGGRLD---LADHSDYSYGEAIVAFDRAARVH 172 MELLT +GWTPA+ LE+VLVQI ++ G RLD L +YS EA AF R AR H Sbjct: 1015 MELLTASGWTPAYALESVLVQIIAEMMSGNARLDQTSLQSGIEYSEAEAKAAFTRVARDH 1074 Query: 173 NW 178 W Sbjct: 1075 GW 1076 >BAK02238.1 predicted protein [Hordeum vulgare subsp. vulgare] Length = 333 Score = 58.2 bits (139), Expect = 9e-08 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 2/64 (3%) Frame = +2 Query: 2 MELLTPAGWTPAFNLEAVLVQIHNAILEGGGRLDLADHSDYSY--GEAIVAFDRAARVHN 175 MELLT +GW ++E++L+QI + +L GG RLD ++ ++Y Y EA AF RAA H Sbjct: 258 MELLTNSGWNSTNDIESILIQIRSEMLSGGARLDHSNSTNYEYSESEAWDAFYRAASTHG 317 Query: 176 WILD 187 W D Sbjct: 318 WKTD 321 >XP_005778232.1 hypothetical protein EMIHUDRAFT_354118 [Emiliania huxleyi CCMP1516] EOD25803.1 hypothetical protein EMIHUDRAFT_354118 [Emiliania huxleyi CCMP1516] Length = 302 Score = 57.8 bits (138), Expect = 1e-07 Identities = 31/60 (51%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = +2 Query: 2 MELLTPAGWTPAFNLEAVLVQIHNAILEGGGRLD-LADHSDYSYGEAIVAFDRAARVHNW 178 MELLT AGW P + L +VLVQ+ A++ GGGRLD YS EA AF R A+ H W Sbjct: 236 MELLTSAGWRPEYTLRSVLVQVRAAMIAGGGRLDPRRPQVPYSKDEARRAFWRVAQQHGW 295 >XP_014538829.1 Ubiquitin conjugating enzyme, putative [Penicillium digitatum Pd1] EKV16610.1 Ubiquitin conjugating enzyme, putative [Penicillium digitatum PHI26] EKV22010.1 Ubiquitin conjugating enzyme, putative [Penicillium digitatum Pd1] Length = 1134 Score = 57.8 bits (138), Expect = 1e-07 Identities = 32/67 (47%), Positives = 42/67 (62%), Gaps = 4/67 (5%) Frame = +2 Query: 2 MELLTPAGWTPAFNLEAVLVQIHNAILEGG---GRLDL-ADHSDYSYGEAIVAFDRAARV 169 MELLT +GW P ++E+VL+Q+ AI RL+L A H DYS GEA+ A+ R A V Sbjct: 1061 MELLTHSGWLPTASIESVLLQVRMAITNTDPRPARLNLNARHRDYSVGEAVEAYRRVALV 1120 Query: 170 HNWILDK 190 H W + K Sbjct: 1121 HGWQVSK 1127 >KXG45753.1 Ubiquitin-conjugating enzyme, E2 [Penicillium griseofulvum] Length = 1134 Score = 57.4 bits (137), Expect = 2e-07 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 3/72 (4%) Frame = +2 Query: 2 MELLTPAGWTPAFNLEAVLVQIHNAILEGG---GRLDLADHSDYSYGEAIVAFDRAARVH 172 MELLT +GW P ++E+VL+Q+ AI RL+L DYS GEA+ A+ R A H Sbjct: 1062 MELLTHSGWLPTASIESVLLQVRMAITNTDPKPARLNLHSPGDYSVGEAVEAYRRVAMAH 1121 Query: 173 NWILDKQPAKVI 208 W + K +++ Sbjct: 1122 GWEISKDIGQLV 1133 >KXX82047.1 Ubiquitin-conjugating enzyme E2 Q2 [Madurella mycetomatis] Length = 1205 Score = 57.4 bits (137), Expect = 2e-07 Identities = 32/70 (45%), Positives = 42/70 (60%), Gaps = 9/70 (12%) Frame = +2 Query: 2 MELLTPAGWTPAFNLEAVLVQIHNAI---------LEGGGRLDLADHSDYSYGEAIVAFD 154 MELLT +GW+PA N+E+VL+Q+ A+ L+ R D +DY GEAI AF Sbjct: 1126 MELLTSSGWSPANNIESVLLQVRMAMCNLEPTPARLDPSVRRD-GPRNDYGVGEAIEAFT 1184 Query: 155 RAARVHNWIL 184 RAAR H W + Sbjct: 1185 RAARAHGWAI 1194 >OJJ62458.1 hypothetical protein ASPSYDRAFT_41126 [Aspergillus sydowii CBS 593.65] Length = 1118 Score = 57.0 bits (136), Expect = 3e-07 Identities = 31/72 (43%), Positives = 43/72 (59%), Gaps = 4/72 (5%) Frame = +2 Query: 2 MELLTPAGWTPAFNLEAVLVQIHNAI---LEGGGRLDL-ADHSDYSYGEAIVAFDRAARV 169 MELLT +GW PAF++E+VL+Q+ AI L RLD + +Y+ GEAI + R Sbjct: 1045 MELLTTSGWLPAFSIESVLLQVRLAITNELPRPARLDFNSSRREYAIGEAIHEYKRVCIA 1104 Query: 170 HNWILDKQPAKV 205 HNW + K K+ Sbjct: 1105 HNWAIPKDLDKI 1116 >KUM59181.1 hypothetical protein ACN42_g7968 [Penicillium freii] Length = 1130 Score = 57.0 bits (136), Expect = 3e-07 Identities = 31/67 (46%), Positives = 44/67 (65%), Gaps = 4/67 (5%) Frame = +2 Query: 2 MELLTPAGWTPAFNLEAVLVQIHNAILE---GGGRLDL-ADHSDYSYGEAIVAFDRAARV 169 MELLT +GW P ++E+VL+Q+ A+ RL+L A +DYS GEA+ A+ RAAR+ Sbjct: 1057 MELLTHSGWLPTASIESVLLQVRMALTTTEPSPARLNLTARLNDYSVGEAVEAYRRAARL 1116 Query: 170 HNWILDK 190 H W + K Sbjct: 1117 HGWQISK 1123 >XP_004340442.1 Ubiquitinconjugating enzyme subfamily protein [Acanthamoeba castellanii str. Neff] ELR18414.1 Ubiquitinconjugating enzyme subfamily protein [Acanthamoeba castellanii str. Neff] Length = 199 Score = 55.8 bits (133), Expect = 3e-07 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Frame = +2 Query: 11 LTPAGWTPAFNLEAVLVQIHNAILEGGGRLDLADH-SDYSYGEAIVAFDRAARVHNW 178 LT +GW+ F L+ V I N +LEGG +D+ ++ +DYS EA AFDR AR H W Sbjct: 141 LTRSGWSAEFQLQPFFVMIRNLLLEGGALVDMDNYATDYSEQEAREAFDRVARAHGW 197 >XP_016599188.1 Ubiquitin-conjugating enzyme, E2 [Penicillium expansum] KGO37303.1 Ubiquitin-conjugating enzyme, E2 [Penicillium expansum] KGO57530.1 Ubiquitin-conjugating enzyme, E2 [Penicillium expansum] KGO66078.1 Ubiquitin-conjugating enzyme, E2 [Penicillium expansum] Length = 1136 Score = 56.6 bits (135), Expect = 4e-07 Identities = 31/72 (43%), Positives = 43/72 (59%), Gaps = 4/72 (5%) Frame = +2 Query: 2 MELLTPAGWTPAFNLEAVLVQIHNAILEGG---GRLDL-ADHSDYSYGEAIVAFDRAARV 169 MELLT +GW P ++E+VL+Q+ AI RL++ A H DYS GEA+ A+ R A Sbjct: 1063 MELLTHSGWLPTASIESVLLQVRMAITNTDPRPARLNINARHMDYSVGEAVEAYRRVALA 1122 Query: 170 HNWILDKQPAKV 205 H W + K K+ Sbjct: 1123 HGWQISKDIQKL 1134 >EDP50745.1 ubiquitin conjugating enzyme, putative [Aspergillus fumigatus A1163] Length = 1158 Score = 56.6 bits (135), Expect = 4e-07 Identities = 31/78 (39%), Positives = 45/78 (57%), Gaps = 4/78 (5%) Frame = +2 Query: 2 MELLTPAGWTPAFNLEAVLVQIHNAILEGG---GRLDL-ADHSDYSYGEAIVAFDRAARV 169 MELLT +GW P ++E+VL+Q+ AI RL L SDYS GEA+ A+ RA Sbjct: 1058 MELLTNSGWLPTASIESVLLQVRMAITNPEPRPARLALNRSRSDYSVGEAVEAYKRACLA 1117 Query: 170 HNWILDKQPAKVIPKSYF 223 H W + + ++ P+ Y+ Sbjct: 1118 HGWQIPEDIQRLSPRIYY 1135 >KEY81511.1 ubiquitin conjugating enzyme [Aspergillus fumigatus var. RP-2014] Length = 1158 Score = 56.6 bits (135), Expect = 4e-07 Identities = 31/78 (39%), Positives = 45/78 (57%), Gaps = 4/78 (5%) Frame = +2 Query: 2 MELLTPAGWTPAFNLEAVLVQIHNAILEGG---GRLDL-ADHSDYSYGEAIVAFDRAARV 169 MELLT +GW P ++E+VL+Q+ AI RL L SDYS GEA+ A+ RA Sbjct: 1058 MELLTNSGWLPTASIESVLLQVRMAITNPEPRPARLALNRSRSDYSVGEAVEAYKRACLA 1117 Query: 170 HNWILDKQPAKVIPKSYF 223 H W + + ++ P+ Y+ Sbjct: 1118 HGWQIPEDIQRLSPRIYY 1135 >XP_005761313.1 hypothetical protein EMIHUDRAFT_317118 [Emiliania huxleyi CCMP1516] EOD08884.1 hypothetical protein EMIHUDRAFT_317118 [Emiliania huxleyi CCMP1516] Length = 265 Score = 55.8 bits (133), Expect = 5e-07 Identities = 30/59 (50%), Positives = 36/59 (61%), Gaps = 1/59 (1%) Frame = +2 Query: 5 ELLTPAGWTPAFNLEAVLVQIHNAILEGGGRLD-LADHSDYSYGEAIVAFDRAARVHNW 178 ELLT AGW P + L +VLVQ+ A++ GGGRLD YS EA AF R A+ H W Sbjct: 200 ELLTSAGWRPEYTLRSVLVQVRAAMIAGGGRLDPRRPQVPYSKDEARRAFWRVAQQHGW 258 >XP_005768000.1 hypothetical protein EMIHUDRAFT_459287 [Emiliania huxleyi CCMP1516] EOD15571.1 hypothetical protein EMIHUDRAFT_459287 [Emiliania huxleyi CCMP1516] Length = 631 Score = 55.8 bits (133), Expect = 6e-07 Identities = 26/60 (43%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = +2 Query: 2 MELLTPAGWTPAFNLEAVLVQIHNAILEGGGRLD-LADHSDYSYGEAIVAFDRAARVHNW 178 +E LT +GW ++E VL+ + +A +GGGRLD + H Y+ EA AF+R AR H W Sbjct: 570 LETLTTSGWNSELSMEGVLLLVRSAFADGGGRLDPVRAHVPYAEREARAAFERVARAHGW 629 >XP_005792402.1 hypothetical protein EMIHUDRAFT_466615 [Emiliania huxleyi CCMP1516] EOD39973.1 hypothetical protein EMIHUDRAFT_466615 [Emiliania huxleyi CCMP1516] Length = 643 Score = 55.8 bits (133), Expect = 6e-07 Identities = 26/60 (43%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = +2 Query: 2 MELLTPAGWTPAFNLEAVLVQIHNAILEGGGRLD-LADHSDYSYGEAIVAFDRAARVHNW 178 +E LT +GW ++E VL+ + +A +GGGRLD + H Y+ EA AF+R AR H W Sbjct: 582 LETLTTSGWNSELSMEGVLLLVRSAFADGGGRLDPVRAHVPYAEREARAAFERVARAHGW 641 >XP_004342069.1 Ubiquitinconjugating enzyme subfamily protein [Acanthamoeba castellanii str. Neff] ELR19960.1 Ubiquitinconjugating enzyme subfamily protein [Acanthamoeba castellanii str. Neff] Length = 371 Score = 55.5 bits (132), Expect = 8e-07 Identities = 26/57 (45%), Positives = 35/57 (61%) Frame = +2 Query: 8 LLTPAGWTPAFNLEAVLVQIHNAILEGGGRLDLADHSDYSYGEAIVAFDRAARVHNW 178 +LT GW + L+ V+V I + GGGRLDL++ SDY+ EA+VAF R H W Sbjct: 310 MLTNDGWIATYRLDQVMVDIAAMLGSGGGRLDLSNRSDYTEEEAMVAFRRMLDTHGW 366