BLASTX nr result
ID: Ephedra29_contig00026215
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00026215 (281 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019152942.1 PREDICTED: lysine histidine transporter-like 8 [I... 75 6e-14 XP_019175090.1 PREDICTED: lysine histidine transporter-like 8 [I... 75 8e-14 AEP14525.1 lysine/histidine transporter [Phytolacca acinosa] 75 8e-14 CAJ34815.1 amino acid permease, partial [Plantago major] 70 2e-13 OAY68657.1 Lysine histidine transporter-like 8 [Ananas comosus] 73 5e-13 XP_020104607.1 lysine histidine transporter-like 8 [Ananas comosus] 73 5e-13 JAT54185.1 Lysine histidine transporter-like 8 [Anthurium amnicola] 71 2e-12 XP_012845451.1 PREDICTED: lysine histidine transporter-like 8 [E... 71 2e-12 JAT44679.1 Lysine histidine transporter-like 8 [Anthurium amnicola] 71 2e-12 OAY22899.1 hypothetical protein MANES_18G035300 [Manihot esculenta] 71 2e-12 KZV45207.1 lysine histidine transporter-like 8 [Dorcoceras hygro... 71 2e-12 XP_009364081.1 PREDICTED: lysine histidine transporter-like 8 [P... 71 2e-12 XP_008378495.1 PREDICTED: lysine histidine transporter-like 8 [M... 71 2e-12 XP_008220718.1 PREDICTED: lysine histidine transporter-like 8 [P... 71 2e-12 XP_007222812.1 hypothetical protein PRUPE_ppa004223mg [Prunus pe... 71 2e-12 JAT63851.1 Lysine histidine transporter-like 8 [Anthurium amnicola] 71 2e-12 XP_009411314.1 PREDICTED: lysine histidine transporter-like 8 [M... 71 2e-12 ONK60116.1 uncharacterized protein A4U43_C08F14490 [Asparagus of... 70 3e-12 KJB63788.1 hypothetical protein B456_010G016000 [Gossypium raimo... 70 3e-12 KZM96239.1 hypothetical protein DCAR_019481 [Daucus carota subsp... 70 3e-12 >XP_019152942.1 PREDICTED: lysine histidine transporter-like 8 [Ipomoea nil] Length = 522 Score = 75.5 bits (184), Expect = 6e-14 Identities = 32/51 (62%), Positives = 38/51 (74%) Frame = +3 Query: 30 FSCMNNKPCPQWPRSGFQIFYVFFDYLIAVAFPFLESLTGLMGGLTLPVTF 182 +S N+PCP W RSGF++FY FF + I VA PFL S GL+GGLTLPVTF Sbjct: 414 YSSRTNRPCPIWVRSGFRVFYGFFSFFIGVALPFLSSFAGLLGGLTLPVTF 464 >XP_019175090.1 PREDICTED: lysine histidine transporter-like 8 [Ipomoea nil] Length = 516 Score = 75.1 bits (183), Expect = 8e-14 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = +3 Query: 30 FSCMNNKPCPQWPRSGFQIFYVFFDYLIAVAFPFLESLTGLMGGLTLPVTF 182 ++ N+PC W RSGF++FY FF + I VA PFL SLTGL+GGLTLPVTF Sbjct: 407 YTSRTNRPCSVWVRSGFRVFYGFFSFFIGVALPFLSSLTGLLGGLTLPVTF 457 >AEP14525.1 lysine/histidine transporter [Phytolacca acinosa] Length = 521 Score = 75.1 bits (183), Expect = 8e-14 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = +3 Query: 30 FSCMNNKPCPQWPRSGFQIFYVFFDYLIAVAFPFLESLTGLMGGLTLPVTF 182 ++C N+PC W RSGF++ Y F + LI VAFPFL SL GL+GGLTLPVTF Sbjct: 413 YTCRTNRPCSVWVRSGFRVIYGFINLLIGVAFPFLSSLAGLLGGLTLPVTF 463 >CAJ34815.1 amino acid permease, partial [Plantago major] Length = 136 Score = 70.5 bits (171), Expect = 2e-13 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = +3 Query: 30 FSCMNNKPCPQWPRSGFQIFYVFFDYLIAVAFPFLESLTGLMGGLTLPVTF 182 ++ N+PC W RSGF++FY F LI VA PFL SL GL+GGLTLPVTF Sbjct: 28 YTSRTNRPCSIWVRSGFRVFYGFISLLIGVALPFLSSLAGLLGGLTLPVTF 78 >OAY68657.1 Lysine histidine transporter-like 8 [Ananas comosus] Length = 546 Score = 72.8 bits (177), Expect = 5e-13 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = +3 Query: 30 FSCMNNKPCPQWPRSGFQIFYVFFDYLIAVAFPFLESLTGLMGGLTLPVTF 182 ++ N+PC W RSGF++FY F + I VAFPFL SL GL+GGLTLPVTF Sbjct: 438 YTSRTNRPCSIWVRSGFRVFYGFISFFIGVAFPFLSSLAGLLGGLTLPVTF 488 >XP_020104607.1 lysine histidine transporter-like 8 [Ananas comosus] Length = 549 Score = 72.8 bits (177), Expect = 5e-13 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = +3 Query: 30 FSCMNNKPCPQWPRSGFQIFYVFFDYLIAVAFPFLESLTGLMGGLTLPVTF 182 ++ N+PC W RSGF++FY F + I VAFPFL SL GL+GGLTLPVTF Sbjct: 441 YTSRTNRPCSIWVRSGFRVFYGFISFFIGVAFPFLSSLAGLLGGLTLPVTF 491 >JAT54185.1 Lysine histidine transporter-like 8 [Anthurium amnicola] Length = 317 Score = 70.9 bits (172), Expect = 2e-12 Identities = 30/51 (58%), Positives = 37/51 (72%) Frame = +3 Query: 30 FSCMNNKPCPQWPRSGFQIFYVFFDYLIAVAFPFLESLTGLMGGLTLPVTF 182 ++ N+PC W RSGF++FY F + I VA PFL SL GL+GGLTLPVTF Sbjct: 209 YTSRTNRPCSVWVRSGFRVFYGFISFFIGVALPFLSSLAGLLGGLTLPVTF 259 >XP_012845451.1 PREDICTED: lysine histidine transporter-like 8 [Erythranthe guttata] EYU45070.1 hypothetical protein MIMGU_mgv1a004478mg [Erythranthe guttata] Length = 525 Score = 71.2 bits (173), Expect = 2e-12 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = +3 Query: 45 NKPCPQWPRSGFQIFYVFFDYLIAVAFPFLESLTGLMGGLTLPVTF 182 N+PCP W RSGF++FY F I VA PFL SL GL+GGLTLPVTF Sbjct: 421 NRPCPIWVRSGFRVFYGFISLFIGVALPFLSSLAGLLGGLTLPVTF 466 >JAT44679.1 Lysine histidine transporter-like 8 [Anthurium amnicola] Length = 396 Score = 70.9 bits (172), Expect = 2e-12 Identities = 30/51 (58%), Positives = 37/51 (72%) Frame = +3 Query: 30 FSCMNNKPCPQWPRSGFQIFYVFFDYLIAVAFPFLESLTGLMGGLTLPVTF 182 ++ N+PC W RSGF++FY F + I VA PFL SL GL+GGLTLPVTF Sbjct: 288 YTSRTNRPCSVWVRSGFRVFYGFISFFIGVALPFLSSLAGLLGGLTLPVTF 338 >OAY22899.1 hypothetical protein MANES_18G035300 [Manihot esculenta] Length = 521 Score = 70.9 bits (172), Expect = 2e-12 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = +3 Query: 45 NKPCPQWPRSGFQIFYVFFDYLIAVAFPFLESLTGLMGGLTLPVTF 182 N+PC W RSGF++F FF + I VAFPFL SL GL+GGLTLPVTF Sbjct: 417 NRPCSIWVRSGFRVFCGFFSFFIGVAFPFLSSLAGLLGGLTLPVTF 462 >KZV45207.1 lysine histidine transporter-like 8 [Dorcoceras hygrometricum] Length = 521 Score = 70.9 bits (172), Expect = 2e-12 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = +3 Query: 30 FSCMNNKPCPQWPRSGFQIFYVFFDYLIAVAFPFLESLTGLMGGLTLPVTF 182 ++ N+PC W RSGF++FY F LI VA PFL SL GL+GGLTLPVTF Sbjct: 412 YTSRTNRPCSVWVRSGFRVFYGFISLLIGVALPFLSSLAGLLGGLTLPVTF 462 >XP_009364081.1 PREDICTED: lysine histidine transporter-like 8 [Pyrus x bretschneideri] Length = 522 Score = 70.9 bits (172), Expect = 2e-12 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = +3 Query: 30 FSCMNNKPCPQWPRSGFQIFYVFFDYLIAVAFPFLESLTGLMGGLTLPVTF 182 ++ N+PC W RSGF++FY F ++ I VA PFL SL GL+GGLTLPVTF Sbjct: 413 YTSRTNRPCSIWVRSGFRVFYGFINFFIGVALPFLSSLAGLLGGLTLPVTF 463 >XP_008378495.1 PREDICTED: lysine histidine transporter-like 8 [Malus domestica] Length = 522 Score = 70.9 bits (172), Expect = 2e-12 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = +3 Query: 30 FSCMNNKPCPQWPRSGFQIFYVFFDYLIAVAFPFLESLTGLMGGLTLPVTF 182 ++ N+PC W RSGF++FY F ++ I VA PFL SL GL+GGLTLPVTF Sbjct: 413 YTSRTNRPCSIWVRSGFRVFYGFINFFIGVALPFLSSLAGLLGGLTLPVTF 463 >XP_008220718.1 PREDICTED: lysine histidine transporter-like 8 [Prunus mume] Length = 522 Score = 70.9 bits (172), Expect = 2e-12 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = +3 Query: 30 FSCMNNKPCPQWPRSGFQIFYVFFDYLIAVAFPFLESLTGLMGGLTLPVTF 182 ++ N+PC W RSGF++FY F ++ I VA PFL SL GL+GGLTLPVTF Sbjct: 413 YTSRTNRPCSIWVRSGFRVFYGFINFFIGVALPFLSSLAGLLGGLTLPVTF 463 >XP_007222812.1 hypothetical protein PRUPE_ppa004223mg [Prunus persica] ONI32828.1 hypothetical protein PRUPE_1G388700 [Prunus persica] Length = 522 Score = 70.9 bits (172), Expect = 2e-12 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = +3 Query: 30 FSCMNNKPCPQWPRSGFQIFYVFFDYLIAVAFPFLESLTGLMGGLTLPVTF 182 ++ N+PC W RSGF++FY F ++ I VA PFL SL GL+GGLTLPVTF Sbjct: 413 YTSRTNRPCSIWVRSGFRVFYGFINFFIGVALPFLSSLAGLLGGLTLPVTF 463 >JAT63851.1 Lysine histidine transporter-like 8 [Anthurium amnicola] Length = 541 Score = 70.9 bits (172), Expect = 2e-12 Identities = 30/51 (58%), Positives = 37/51 (72%) Frame = +3 Query: 30 FSCMNNKPCPQWPRSGFQIFYVFFDYLIAVAFPFLESLTGLMGGLTLPVTF 182 ++ N+PC W RSGF++FY F + I VA PFL SL GL+GGLTLPVTF Sbjct: 433 YTSRTNRPCSVWVRSGFRVFYGFISFFIGVALPFLSSLAGLLGGLTLPVTF 483 >XP_009411314.1 PREDICTED: lysine histidine transporter-like 8 [Musa acuminata subsp. malaccensis] Length = 547 Score = 70.9 bits (172), Expect = 2e-12 Identities = 30/51 (58%), Positives = 37/51 (72%) Frame = +3 Query: 30 FSCMNNKPCPQWPRSGFQIFYVFFDYLIAVAFPFLESLTGLMGGLTLPVTF 182 ++ N+PC W RSGF++FY F + I VA PFL SL GL+GGLTLPVTF Sbjct: 439 YTSRTNRPCSVWVRSGFRVFYGFISFFIGVALPFLSSLAGLLGGLTLPVTF 489 >ONK60116.1 uncharacterized protein A4U43_C08F14490 [Asparagus officinalis] Length = 355 Score = 70.5 bits (171), Expect = 3e-12 Identities = 30/51 (58%), Positives = 37/51 (72%) Frame = +3 Query: 30 FSCMNNKPCPQWPRSGFQIFYVFFDYLIAVAFPFLESLTGLMGGLTLPVTF 182 ++ N+PC W RSGF++FY F + I VA PFL SL GL+GGLTLPVTF Sbjct: 247 YTSRTNRPCSIWVRSGFRVFYGFISFFIGVALPFLSSLAGLLGGLTLPVTF 297 >KJB63788.1 hypothetical protein B456_010G016000 [Gossypium raimondii] Length = 483 Score = 70.5 bits (171), Expect = 3e-12 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = +3 Query: 30 FSCMNNKPCPQWPRSGFQIFYVFFDYLIAVAFPFLESLTGLMGGLTLPVTF 182 ++ N+PC W RSGF++FY F ++ I VA PFL SL GL+GGLTLPVTF Sbjct: 375 YTSRTNRPCSIWVRSGFRVFYGFVNFFIGVALPFLSSLAGLLGGLTLPVTF 425 >KZM96239.1 hypothetical protein DCAR_019481 [Daucus carota subsp. sativus] Length = 493 Score = 70.5 bits (171), Expect = 3e-12 Identities = 30/51 (58%), Positives = 37/51 (72%) Frame = +3 Query: 30 FSCMNNKPCPQWPRSGFQIFYVFFDYLIAVAFPFLESLTGLMGGLTLPVTF 182 ++ N+PC W RSGF++FY F + I VA PFL SL GL+GGLTLPVTF Sbjct: 384 YTSRTNRPCSIWVRSGFRVFYGFISFFIGVALPFLSSLAGLLGGLTLPVTF 434