BLASTX nr result
ID: Ephedra29_contig00026209
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00026209 (323 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018727687.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 5e-06 >XP_018727687.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16470 [Eucalyptus grandis] Length = 466 Score = 53.5 bits (127), Expect = 5e-06 Identities = 28/77 (36%), Positives = 48/77 (62%), Gaps = 4/77 (5%) Frame = +3 Query: 96 GSATEALKALMKNG-RADAETCAVALRE---TPSISHGKTIHAKIILCGLAPNAFLGNNL 263 G TEA++ L G + DAET A+ ++E + + +G+ +HA++++ G P+A++ L Sbjct: 59 GRLTEAVRLLCNTGVQVDAETYALLVQECIYSKAYENGRIVHAQMVVVGYVPDAYMKTKL 118 Query: 264 LLMYTKHGTLGDANKAF 314 L++YTK G L AN F Sbjct: 119 LILYTKLGDLNTANILF 135