BLASTX nr result
ID: Ephedra29_contig00026203
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00026203 (333 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CCP29686.1 HD transcription factor [Gnetum gnemon] 64 6e-10 CAT02929.1 putative wuschel homeobox protein WOX2, partial [Gnet... 58 4e-09 ADE77607.1 unknown [Picea sitchensis] 53 2e-06 >CCP29686.1 HD transcription factor [Gnetum gnemon] Length = 214 Score = 63.5 bits (153), Expect = 6e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 244 VRWNPTKEQLRILENVYNGGNRSPRTEQIQ 333 VRWNPTKEQLR LENVYNGGN+SPRTEQIQ Sbjct: 39 VRWNPTKEQLRTLENVYNGGNKSPRTEQIQ 68 >CAT02929.1 putative wuschel homeobox protein WOX2, partial [Gnetum gnemon] Length = 50 Score = 57.8 bits (138), Expect = 4e-09 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 253 NPTKEQLRILENVYNGGNRSPRTEQIQ 333 NPTKEQLRILENVYNGGN+SPRTEQIQ Sbjct: 2 NPTKEQLRILENVYNGGNKSPRTEQIQ 28 >ADE77607.1 unknown [Picea sitchensis] Length = 159 Score = 53.1 bits (126), Expect = 2e-06 Identities = 21/29 (72%), Positives = 27/29 (93%) Frame = +1 Query: 247 RWNPTKEQLRILENVYNGGNRSPRTEQIQ 333 RW+PT+EQLRILE +YNGGN++P+ EQIQ Sbjct: 11 RWSPTREQLRILETIYNGGNQTPKPEQIQ 39