BLASTX nr result
ID: Ephedra29_contig00025918
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00025918 (304 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002987123.1 hypothetical protein SELMODRAFT_269219 [Selaginel... 53 6e-06 >XP_002987123.1 hypothetical protein SELMODRAFT_269219 [Selaginella moellendorffii] EFJ11699.1 hypothetical protein SELMODRAFT_269219 [Selaginella moellendorffii] Length = 892 Score = 53.1 bits (126), Expect = 6e-06 Identities = 27/59 (45%), Positives = 38/59 (64%), Gaps = 4/59 (6%) Frame = +2 Query: 2 GYAVAVLGPLVTQWKPSSSQTQDNEDSQVGMTPEQAFKQWKIFDDS----SFSIPPTRP 166 G+AV+VL PLV QWKP++S ++ + + +T QA KQW+ DDS S + PTRP Sbjct: 821 GHAVSVLAPLVEQWKPTASDGEETKGIDLNVTLPQALKQWQASDDSNLDDSQASLPTRP 879