BLASTX nr result
ID: Ephedra29_contig00025823
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00025823 (213 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EZY42791.1 hypothetical protein V052_02628, partial [Staphylococ... 50 1e-06 ENW76859.1 hypothetical protein F911_00700, partial [Acinetobact... 48 4e-06 JAN94735.1 daphnid bacterial-ribosomal-RNA-like, possible HGT [D... 49 6e-06 CDW93820.1 hypothetical protein THICB2_410075 [Thiomonas sp. CB2] 39 1e-05 >EZY42791.1 hypothetical protein V052_02628, partial [Staphylococcus aureus MSSA-93] EZY42792.1 hypothetical protein V052_02627, partial [Staphylococcus aureus MSSA-93] Length = 74 Score = 50.4 bits (119), Expect = 1e-06 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = +2 Query: 11 ANLLAV*AFPHRFPLSHDFGTLADGLGCFPLHDGR*HP 124 AN+L V A PH FPL+ FGTLA GLGCFP G HP Sbjct: 1 ANILVVWATPHPFPLNIYFGTLAGGLGCFPFEHGPYHP 38 >ENW76859.1 hypothetical protein F911_00700, partial [Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841] Length = 27 Score = 48.1 bits (113), Expect = 4e-06 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = +2 Query: 35 FPHRFPLSHDFGTLADGLGCFPLHDGR 115 FPHRFPL++DFG LA GL CFPL GR Sbjct: 1 FPHRFPLNYDFGALAGGLDCFPLDYGR 27 >JAN94735.1 daphnid bacterial-ribosomal-RNA-like, possible HGT [Daphnia magna] Length = 100 Score = 49.3 bits (116), Expect = 6e-06 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = +1 Query: 70 DLS*RSGLFPSSRRTLAPAVCLPCSALVGIRSLHRFGKS 186 DLS RSGLFPS RTLAP P AL+GIRSL FGKS Sbjct: 61 DLSWRSGLFPSCVRTLAPGALSPKLALIGIRSLPWFGKS 99 >CDW93820.1 hypothetical protein THICB2_410075 [Thiomonas sp. CB2] Length = 59 Score = 38.5 bits (88), Expect(2) = 1e-05 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -3 Query: 61 MAKWETMWEGLDS*EVGLEA 2 +AKWET WEG+DS EVGLEA Sbjct: 37 IAKWETKWEGIDSQEVGLEA 56 Score = 38.1 bits (87), Expect(2) = 1e-05 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -2 Query: 137 GRHTAGANVRREEGNNPDRQLRS 69 G GANVR +EGNNPDRQLRS Sbjct: 12 GDSAPGANVRTQEGNNPDRQLRS 34