BLASTX nr result
ID: Ephedra29_contig00025811
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00025811 (319 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010251049.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 1e-08 XP_010929894.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 2e-08 EPS62186.1 hypothetical protein M569_12607 [Genlisea aurea] 60 2e-08 KVH98184.1 Pentatricopeptide repeat-containing protein [Cynara c... 60 2e-08 XP_019245115.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 3e-08 XP_004952738.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 5e-08 XP_016514917.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 6e-08 XP_009796136.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 6e-08 KHN18411.1 Pentatricopeptide repeat-containing protein, chloropl... 59 9e-08 XP_008804230.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 9e-08 XP_003550712.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 9e-08 XP_015880448.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 9e-08 XP_020110896.1 pentatricopeptide repeat-containing protein At3g4... 58 2e-07 OAY69837.1 Pentatricopeptide repeat-containing protein, chloropl... 58 2e-07 XP_004511384.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 2e-07 XP_009415085.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 2e-07 XP_007155485.1 hypothetical protein PHAVU_003G205400g [Phaseolus... 57 2e-07 XP_016463190.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 2e-07 XP_009613976.2 PREDICTED: pentatricopeptide repeat-containing pr... 57 2e-07 KQJ99938.1 hypothetical protein BRADI_3g46126, partial [Brachypo... 57 3e-07 >XP_010251049.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Nelumbo nucifera] Length = 631 Score = 60.8 bits (146), Expect = 1e-08 Identities = 35/104 (33%), Positives = 53/104 (50%) Frame = -2 Query: 318 ADETDKALALLAEMEESGCAPDAYIIKGFAVHLCHKKRGMDAYNLLCKSIEQHKIKPSDD 139 A E DKALA A+M C DA +++ +C KK+ + AY L + +E+ +++P Sbjct: 457 AGEVDKALACFAKMIGKSCDADADLLEIMVNGMCSKKKVVGAYTLAVEMVEKARLRPWQA 516 Query: 138 TYSEVIHKLSQSGMLNVACKVFDLMKEHGHVPKHCIPLVQPIID 7 TY +I +L G L A + LMK+H P +P ID Sbjct: 517 TYKNLIQRLLGEGKLEEALNLLVLMKKHNFP-----PFPEPFID 555 >XP_010929894.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Elaeis guineensis] Length = 584 Score = 60.5 bits (145), Expect = 2e-08 Identities = 34/92 (36%), Positives = 48/92 (52%) Frame = -2 Query: 318 ADETDKALALLAEMEESGCAPDAYIIKGFAVHLCHKKRGMDAYNLLCKSIEQHKIKPSDD 139 A E +KAL LLA+M E C DA ++ LC K+R AY L+ + +E +I+ Sbjct: 411 AGEVNKALELLAKMIEKNCEADADVLDVLVKGLCSKRRADGAYTLVVEMVESARIRAWQA 470 Query: 138 TYSEVIHKLSQSGMLNVACKVFDLMKEHGHVP 43 TY +I +L ML A K+ + MK H P Sbjct: 471 TYKYLIQELLSVRMLEEALKLLNTMKSHKFPP 502 >EPS62186.1 hypothetical protein M569_12607 [Genlisea aurea] Length = 627 Score = 60.5 bits (145), Expect = 2e-08 Identities = 33/97 (34%), Positives = 49/97 (50%) Frame = -2 Query: 312 ETDKALALLAEMEESGCAPDAYIIKGFAVHLCHKKRGMDAYNLLCKSIEQHKIKPSDDTY 133 ETDKA+ A M E G PDA +++ L K R DA+ LL + E+ K++P T+ Sbjct: 461 ETDKAMLHFARMMEKGFDPDADLLEAIVDELSKKSRAPDAFRLLVELAEKLKLRPWQSTF 520 Query: 132 SEVIHKLSQSGMLNVACKVFDLMKEHGHVPKHCIPLV 22 +I +L A ++ +MK + P HC P V Sbjct: 521 KNLIQQLLDGRRFEEAVRLLAMMKRQNY-PPHCEPFV 556 >KVH98184.1 Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 628 Score = 60.1 bits (144), Expect = 2e-08 Identities = 31/92 (33%), Positives = 49/92 (53%) Frame = -2 Query: 318 ADETDKALALLAEMEESGCAPDAYIIKGFAVHLCHKKRGMDAYNLLCKSIEQHKIKPSDD 139 A+E +KAL LA M E GC DA ++ H++ + A+ LL + +E +KP Sbjct: 456 ANEVEKALIFLANMIEKGCEADADLLDVLINGFLHQENAIAAHQLLTEMVESGGVKPWQA 515 Query: 138 TYSEVIHKLSQSGMLNVACKVFDLMKEHGHVP 43 TY +I KL + + +V LM++HG+ P Sbjct: 516 TYKNLIQKLLAERKIEESLEVLRLMRKHGYPP 547 >XP_019245115.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Nicotiana attenuata] OIT07858.1 pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 897 Score = 60.1 bits (144), Expect = 3e-08 Identities = 36/96 (37%), Positives = 51/96 (53%) Frame = -2 Query: 318 ADETDKALALLAEMEESGCAPDAYIIKGFAVHLCHKKRGMDAYNLLCKSIEQHKIKPSDD 139 A+ D AL L EM E GC+P+A LC + ++A LL + +E +KP+ + Sbjct: 525 AERVDFALTLFKEMIEEGCSPNACTYNVLINGLCKQGNQLEAAQLLQRMLESG-VKPTIE 583 Query: 138 TYSEVIHKLSQSGMLNVACKVFDLMKEHGHVPKHCI 31 +YS +I +L + N A KVF LM GH P CI Sbjct: 584 SYSILIEQLLKESAFNHAYKVFYLMDSMGHKPDVCI 619 >XP_004952738.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Setaria italica] Length = 722 Score = 59.3 bits (142), Expect = 5e-08 Identities = 32/90 (35%), Positives = 49/90 (54%) Frame = -2 Query: 312 ETDKALALLAEMEESGCAPDAYIIKGFAVHLCHKKRGMDAYNLLCKSIEQHKIKPSDDTY 133 + D+AL++L + GC PDA LC +R +A LL + + +K P + T+ Sbjct: 246 DADEALSVLRSLPSRGCKPDAVTYTPVLKSLCSSERWKEAEELLAE-MASNKCAPDEVTF 304 Query: 132 SEVIHKLSQSGMLNVACKVFDLMKEHGHVP 43 + VI L Q G+++ A KV D M EHG +P Sbjct: 305 NTVITSLCQKGLVDRAIKVVDHMSEHGCIP 334 >XP_016514917.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like, partial [Nicotiana tabacum] Length = 726 Score = 58.9 bits (141), Expect = 6e-08 Identities = 35/96 (36%), Positives = 52/96 (54%) Frame = -2 Query: 318 ADETDKALALLAEMEESGCAPDAYIIKGFAVHLCHKKRGMDAYNLLCKSIEQHKIKPSDD 139 A+ D AL L EM E GC+P+A LC + + ++A LL + + + +KP+ + Sbjct: 525 AERVDFALTLFKEMIEEGCSPNACTYNVLINGLCKQGKQLEAAQLL-ERMPESGVKPTIE 583 Query: 138 TYSEVIHKLSQSGMLNVACKVFDLMKEHGHVPKHCI 31 +YS +I +L + N A KVF LM GH P CI Sbjct: 584 SYSILIEQLLKESAFNHAYKVFYLMDSIGHKPDVCI 619 >XP_009796136.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Nicotiana sylvestris] XP_009796137.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Nicotiana sylvestris] Length = 897 Score = 58.9 bits (141), Expect = 6e-08 Identities = 35/96 (36%), Positives = 52/96 (54%) Frame = -2 Query: 318 ADETDKALALLAEMEESGCAPDAYIIKGFAVHLCHKKRGMDAYNLLCKSIEQHKIKPSDD 139 A+ D AL L EM E GC+P+A LC + + ++A LL + + + +KP+ + Sbjct: 525 AERVDFALTLFKEMIEEGCSPNACTYNVLINGLCKQGKQLEAAQLL-ERMPESGVKPTIE 583 Query: 138 TYSEVIHKLSQSGMLNVACKVFDLMKEHGHVPKHCI 31 +YS +I +L + N A KVF LM GH P CI Sbjct: 584 SYSILIEQLLKESAFNHAYKVFYLMDSIGHKPDVCI 619 >KHN18411.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 545 Score = 58.5 bits (140), Expect = 9e-08 Identities = 36/99 (36%), Positives = 51/99 (51%) Frame = -2 Query: 318 ADETDKALALLAEMEESGCAPDAYIIKGFAVHLCHKKRGMDAYNLLCKSIEQHKIKPSDD 139 A+E DKAL A+M E GC PDA ++ A +KR AY L+ + + +I P Sbjct: 364 ANEVDKALLCFAKMIEKGCDPDADLLDVLADGFLSQKRIEGAYELVAEISRKCRISPWQA 423 Query: 138 TYSEVIHKLSQSGMLNVACKVFDLMKEHGHVPKHCIPLV 22 TY ++I KL A ++ LMK H + P H +P V Sbjct: 424 TYKKLIEKLLGVMKFEEALELLRLMKSHNYPPYH-LPFV 461 >XP_008804230.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Phoenix dactylifera] Length = 579 Score = 58.5 bits (140), Expect = 9e-08 Identities = 34/92 (36%), Positives = 45/92 (48%) Frame = -2 Query: 318 ADETDKALALLAEMEESGCAPDAYIIKGFAVHLCHKKRGMDAYNLLCKSIEQHKIKPSDD 139 A E DKAL LL +M E C DA ++ C K+R AY L+ + +E I+P Sbjct: 406 AGEVDKALELLTKMIEKNCEADADVLDVLVKGFCSKRRVDGAYILVVEMVESAHIRPWQA 465 Query: 138 TYSEVIHKLSQSGMLNVACKVFDLMKEHGHVP 43 TY +I +L ML A K+ MK H P Sbjct: 466 TYKYLIQELLSVRMLEEALKLLSTMKSHKFPP 497 >XP_003550712.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Glycine max] KRH03217.1 hypothetical protein GLYMA_17G084400 [Glycine max] Length = 635 Score = 58.5 bits (140), Expect = 9e-08 Identities = 36/99 (36%), Positives = 51/99 (51%) Frame = -2 Query: 318 ADETDKALALLAEMEESGCAPDAYIIKGFAVHLCHKKRGMDAYNLLCKSIEQHKIKPSDD 139 A+E DKAL A+M E GC PDA ++ A +KR AY L+ + + +I P Sbjct: 454 ANEVDKALLCFAKMIEKGCDPDADLLDVLADGFLSQKRIEGAYELVAEISRKCRISPWQA 513 Query: 138 TYSEVIHKLSQSGMLNVACKVFDLMKEHGHVPKHCIPLV 22 TY ++I KL A ++ LMK H + P H +P V Sbjct: 514 TYKKLIEKLLGVMKFEEALELLRLMKSHNYPPYH-LPFV 551 >XP_015880448.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02490, mitochondrial [Ziziphus jujuba] Length = 659 Score = 58.5 bits (140), Expect = 9e-08 Identities = 31/93 (33%), Positives = 46/93 (49%), Gaps = 1/93 (1%) Frame = -2 Query: 318 ADETDKALALLAEM-EESGCAPDAYIIKGFAVHLCHKKRGMDAYNLLCKSIEQHKIKPSD 142 A + DKA + L +M E+ G Y + C K + MDAY LL + + + ++KP Sbjct: 486 AGDLDKASSSLQKMVEKEGANSAGYAFDSLIIAYCRKNKAMDAYKLLNELVSEKQLKPWH 545 Query: 141 DTYSEVIHKLSQSGMLNVACKVFDLMKEHGHVP 43 TY +I KL G A + ++MK HG P Sbjct: 546 STYKVLISKLLVEGGFGYALNILEMMKNHGFPP 578 >XP_020110896.1 pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Ananas comosus] Length = 502 Score = 57.8 bits (138), Expect = 2e-07 Identities = 32/92 (34%), Positives = 46/92 (50%) Frame = -2 Query: 318 ADETDKALALLAEMEESGCAPDAYIIKGFAVHLCHKKRGMDAYNLLCKSIEQHKIKPSDD 139 A E DK L LA M E C DA ++ LC K + AYNL + +E+ +++P Sbjct: 329 AGEVDKGLECLARMIEKNCEADADVLDILVKGLCGKSKAEGAYNLFDEMVERARLRPWQA 388 Query: 138 TYSEVIHKLSQSGMLNVACKVFDLMKEHGHVP 43 TY +I +L + ML A K+ MK+ P Sbjct: 389 TYKHLISELLKVRMLEEALKLLGSMKKQNFPP 420 >OAY69837.1 Pentatricopeptide repeat-containing protein, chloroplastic [Ananas comosus] Length = 614 Score = 57.8 bits (138), Expect = 2e-07 Identities = 32/92 (34%), Positives = 46/92 (50%) Frame = -2 Query: 318 ADETDKALALLAEMEESGCAPDAYIIKGFAVHLCHKKRGMDAYNLLCKSIEQHKIKPSDD 139 A E DK L LA M E C DA ++ LC K + AYNL + +E+ +++P Sbjct: 441 AGEVDKGLECLARMIEKNCEADADVLDILVKGLCGKSKAEGAYNLFDEMVERARLRPWQA 500 Query: 138 TYSEVIHKLSQSGMLNVACKVFDLMKEHGHVP 43 TY +I +L + ML A K+ MK+ P Sbjct: 501 TYKHLISELLKVRMLEEALKLLGSMKKQNFPP 532 >XP_004511384.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Cicer arietinum] Length = 557 Score = 57.4 bits (137), Expect = 2e-07 Identities = 30/91 (32%), Positives = 47/91 (51%) Frame = -2 Query: 306 DKALALLAEMEESGCAPDAYIIKGFAVHLCHKKRGMDAYNLLCKSIEQHKIKPSDDTYSE 127 + AL LL EMEE+ C PD + +C KK+ M L + ++ + P TY+ Sbjct: 432 ETALRLLKEMEETSCKPDIQTYHPL-IKMCCKKKRMKVLKFLLDHMFKNDLSPDLGTYTL 490 Query: 126 VIHKLSQSGMLNVACKVFDLMKEHGHVPKHC 34 ++H L++ G L AC+ F+ M G P+ C Sbjct: 491 LVHSLTKCGKLEDACRFFEEMVLKGLTPRQC 521 >XP_009415085.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Musa acuminata subsp. malaccensis] Length = 597 Score = 57.4 bits (137), Expect = 2e-07 Identities = 33/92 (35%), Positives = 44/92 (47%) Frame = -2 Query: 318 ADETDKALALLAEMEESGCAPDAYIIKGFAVHLCHKKRGMDAYNLLCKSIEQHKIKPSDD 139 A E DKAL LL +M E C D ++ LC R L + +E+ +KP Sbjct: 424 AGEVDKALELLTKMIEKNCEADGDVLDVLVKGLCSNNRADAGCTLFHEMVEKVHVKPWQA 483 Query: 138 TYSEVIHKLSQSGMLNVACKVFDLMKEHGHVP 43 TY +I +L +SGML A K+ MK H P Sbjct: 484 TYKHLIQELLKSGMLEEALKLLSSMKIHKFPP 515 >XP_007155485.1 hypothetical protein PHAVU_003G205400g [Phaseolus vulgaris] ESW27479.1 hypothetical protein PHAVU_003G205400g [Phaseolus vulgaris] Length = 636 Score = 57.4 bits (137), Expect = 2e-07 Identities = 34/103 (33%), Positives = 50/103 (48%) Frame = -2 Query: 318 ADETDKALALLAEMEESGCAPDAYIIKGFAVHLCHKKRGMDAYNLLCKSIEQHKIKPSDD 139 A E DKAL L +M E GC DA ++ +KR DAY LL K + +H PS Sbjct: 458 ASEVDKALLCLHKMIEKGCNLDATVLSVLTDSFLGQKRIDDAYKLLVKVVTKHGASPSHG 517 Query: 138 TYSEVIHKLSQSGMLNVACKVFDLMKEHGHVPKHCIPLVQPII 10 TY ++I L + A + L ++H C P+++P + Sbjct: 518 TYKKLIVNLLEIEKFEEALNLLCLTRKH-----KCTPILEPFV 555 >XP_016463190.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Nicotiana tabacum] Length = 949 Score = 57.4 bits (137), Expect = 2e-07 Identities = 34/96 (35%), Positives = 54/96 (56%) Frame = -2 Query: 318 ADETDKALALLAEMEESGCAPDAYIIKGFAVHLCHKKRGMDAYNLLCKSIEQHKIKPSDD 139 A++ D AL L +M E GC+P+A LC + + ++A LL K + + +KP+ + Sbjct: 577 AEKVDFALTLCKKMIEEGCSPNACTYNVLINGLCKQGKQLEAAQLL-KRMPESGVKPTIE 635 Query: 138 TYSEVIHKLSQSGMLNVACKVFDLMKEHGHVPKHCI 31 +YS +I +L + + A KVF+LM GH P CI Sbjct: 636 SYSILIEQLLKECAFDHAYKVFNLMVSMGHKPDVCI 671 >XP_009613976.2 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Nicotiana tomentosiformis] Length = 959 Score = 57.4 bits (137), Expect = 2e-07 Identities = 34/96 (35%), Positives = 54/96 (56%) Frame = -2 Query: 318 ADETDKALALLAEMEESGCAPDAYIIKGFAVHLCHKKRGMDAYNLLCKSIEQHKIKPSDD 139 A++ D AL L +M E GC+P+A LC + + ++A LL K + + +KP+ + Sbjct: 587 AEKVDFALTLCKKMIEEGCSPNACTYNVLINGLCKQGKQLEAAQLL-KRMPESGVKPTIE 645 Query: 138 TYSEVIHKLSQSGMLNVACKVFDLMKEHGHVPKHCI 31 +YS +I +L + + A KVF+LM GH P CI Sbjct: 646 SYSILIEQLLKECAFDHAYKVFNLMVSMGHKPDVCI 681 >KQJ99938.1 hypothetical protein BRADI_3g46126, partial [Brachypodium distachyon] Length = 380 Score = 57.0 bits (136), Expect = 3e-07 Identities = 35/102 (34%), Positives = 53/102 (51%) Frame = -2 Query: 306 DKALALLAEMEESGCAPDAYIIKGFAVHLCHKKRGMDAYNLLCKSIEQHKIKPSDDTYSE 127 D+A+ LL++++ GC PD LC +R DA LL + + ++ I P T++ Sbjct: 158 DEAIKLLSDLQSYGCKPDIITYTTLLKGLCCVERWDDAEELLAEMVSKNCI-PDQVTFNT 216 Query: 126 VIHKLSQSGMLNVACKVFDLMKEHGHVPKHCIPLVQPIIDAL 1 +I L Q G+ + A KV D M EHG +P I I+D L Sbjct: 217 IITSLCQKGLFDRAIKVVDEMSEHGCIPD--ITTYNCIVDGL 256