BLASTX nr result
ID: Ephedra29_contig00025729
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00025729 (231 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_001758201.1 predicted protein [Physcomitrella patens] EDQ7702... 73 3e-13 XP_001784949.1 predicted protein [Physcomitrella patens] EDQ5025... 71 1e-12 XP_015881016.1 PREDICTED: BTB/POZ domain-containing protein At5g... 70 3e-12 XP_008798493.1 PREDICTED: BTB/POZ domain-containing protein At5g... 70 3e-12 XP_001757364.1 predicted protein [Physcomitrella patens] EDQ7784... 70 3e-12 XP_007216301.1 hypothetical protein PRUPE_ppa019538mg [Prunus pe... 70 3e-12 ONI18213.1 hypothetical protein PRUPE_3G202400 [Prunus persica] 70 3e-12 XP_008229874.1 PREDICTED: BTB/POZ domain-containing protein At5g... 70 3e-12 XP_002986218.1 hypothetical protein SELMODRAFT_425121 [Selaginel... 70 3e-12 XP_002985040.1 hypothetical protein SELMODRAFT_424061 [Selaginel... 70 3e-12 XP_007142506.1 hypothetical protein PHAVU_008G286400g [Phaseolus... 69 5e-12 XP_010936626.1 PREDICTED: BTB/POZ domain-containing protein At5g... 69 6e-12 OAY33018.1 hypothetical protein MANES_13G063200 [Manihot esculenta] 69 9e-12 XP_009365236.1 PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-co... 69 9e-12 XP_008342185.1 PREDICTED: BTB/POZ domain-containing protein At5g... 69 9e-12 KYP48142.1 BTB/POZ domain-containing protein At1g30440 family [C... 68 2e-11 KOM46335.1 hypothetical protein LR48_Vigan07g003900 [Vigna angul... 67 2e-11 XP_017429680.1 PREDICTED: BTB/POZ domain-containing protein At5g... 67 2e-11 XP_014504218.1 PREDICTED: BTB/POZ domain-containing protein At5g... 67 2e-11 OAE22585.1 hypothetical protein AXG93_731s1280 [Marchantia polym... 67 2e-11 >XP_001758201.1 predicted protein [Physcomitrella patens] EDQ77023.1 predicted protein, partial [Physcomitrella patens] Length = 490 Score = 72.8 bits (177), Expect = 3e-13 Identities = 37/66 (56%), Positives = 46/66 (69%) Frame = -1 Query: 231 PHISPEDRLAVCNFLNCEKLSPEACIHAVQNDLIPLELTVRAMCLQQLQTWRSLKSGCTN 52 P+ + E+R+ VC LNC+KLS EAC HAVQNDL+PL L V+AM +QQLQT G Sbjct: 411 PNCTQEERMVVCRTLNCQKLSLEACTHAVQNDLMPLRLIVQAMFMQQLQT------GSVL 464 Query: 51 LSHLES 34 SH+ES Sbjct: 465 ASHIES 470 >XP_001784949.1 predicted protein [Physcomitrella patens] EDQ50257.1 predicted protein, partial [Physcomitrella patens] Length = 507 Score = 71.2 bits (173), Expect = 1e-12 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = -1 Query: 231 PHISPEDRLAVCNFLNCEKLSPEACIHAVQNDLIPLELTVRAMCLQQLQT 82 P+I+ E+RL VC LNC+KLS E C HAVQNDL+PL L V+AM +QQLQT Sbjct: 458 PNITHEERLRVCRILNCQKLSQEMCTHAVQNDLMPLPLLVQAMFMQQLQT 507 >XP_015881016.1 PREDICTED: BTB/POZ domain-containing protein At5g48130 [Ziziphus jujuba] Length = 671 Score = 70.1 bits (170), Expect = 3e-12 Identities = 31/55 (56%), Positives = 44/55 (80%) Frame = -1 Query: 231 PHISPEDRLAVCNFLNCEKLSPEACIHAVQNDLIPLELTVRAMCLQQLQTWRSLK 67 P++S E++ VC +LNC+KLS EACIHAVQN+L+PL L V+A+ +QQL T ++ K Sbjct: 442 PNMSQEEKGVVCKYLNCQKLSQEACIHAVQNELMPLRLIVQALFVQQLNTHQTFK 496 >XP_008798493.1 PREDICTED: BTB/POZ domain-containing protein At5g48130 [Phoenix dactylifera] Length = 680 Score = 70.1 bits (170), Expect = 3e-12 Identities = 31/55 (56%), Positives = 42/55 (76%) Frame = -1 Query: 231 PHISPEDRLAVCNFLNCEKLSPEACIHAVQNDLIPLELTVRAMCLQQLQTWRSLK 67 P +S ED+ AVC +LNC+KLS E CI AVQNDL+PL L V+A+ +QQL T ++ + Sbjct: 435 PQLSSEDKAAVCKYLNCQKLSQETCIQAVQNDLMPLRLIVQALFVQQLHTHQAFR 489 >XP_001757364.1 predicted protein [Physcomitrella patens] EDQ77849.1 predicted protein, partial [Physcomitrella patens] Length = 461 Score = 69.7 bits (169), Expect = 3e-12 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = -1 Query: 231 PHISPEDRLAVCNFLNCEKLSPEACIHAVQNDLIPLELTVRAMCLQQLQT 82 P + E+RLA+C LNCEKLS +AC HAVQNDL+PL + V+AM +QQLQT Sbjct: 410 PCTTQEERLAICRTLNCEKLSQKACSHAVQNDLMPLRMIVQAMIVQQLQT 459 >XP_007216301.1 hypothetical protein PRUPE_ppa019538mg [Prunus persica] Length = 643 Score = 69.7 bits (169), Expect = 3e-12 Identities = 31/55 (56%), Positives = 44/55 (80%) Frame = -1 Query: 231 PHISPEDRLAVCNFLNCEKLSPEACIHAVQNDLIPLELTVRAMCLQQLQTWRSLK 67 P+IS E++ AVC +LNC+KLS EACI AVQN+L+PL L V+A+ +QQ+ T ++ K Sbjct: 441 PNISQEEKWAVCKYLNCQKLSQEACIEAVQNELMPLRLIVQALFVQQISTHQAFK 495 >ONI18213.1 hypothetical protein PRUPE_3G202400 [Prunus persica] Length = 685 Score = 69.7 bits (169), Expect = 3e-12 Identities = 31/55 (56%), Positives = 44/55 (80%) Frame = -1 Query: 231 PHISPEDRLAVCNFLNCEKLSPEACIHAVQNDLIPLELTVRAMCLQQLQTWRSLK 67 P+IS E++ AVC +LNC+KLS EACI AVQN+L+PL L V+A+ +QQ+ T ++ K Sbjct: 441 PNISQEEKWAVCKYLNCQKLSQEACIEAVQNELMPLRLIVQALFVQQISTHQAFK 495 >XP_008229874.1 PREDICTED: BTB/POZ domain-containing protein At5g48130 [Prunus mume] Length = 685 Score = 69.7 bits (169), Expect = 3e-12 Identities = 31/55 (56%), Positives = 44/55 (80%) Frame = -1 Query: 231 PHISPEDRLAVCNFLNCEKLSPEACIHAVQNDLIPLELTVRAMCLQQLQTWRSLK 67 P+IS E++ AVC +LNC+KLS EACI AVQN+L+PL L V+A+ +QQ+ T ++ K Sbjct: 441 PNISQEEKWAVCKYLNCQKLSQEACIEAVQNELMPLRLIVQALFVQQISTHQAFK 495 >XP_002986218.1 hypothetical protein SELMODRAFT_425121 [Selaginella moellendorffii] EFJ12749.1 hypothetical protein SELMODRAFT_425121 [Selaginella moellendorffii] Length = 748 Score = 69.7 bits (169), Expect = 3e-12 Identities = 36/76 (47%), Positives = 47/76 (61%) Frame = -1 Query: 231 PHISPEDRLAVCNFLNCEKLSPEACIHAVQNDLIPLELTVRAMCLQQLQTWRSLKSGCTN 52 PH++ +RL VC LNC+KLS EACIHAVQN+L+PL V+AM ++QLQ+ Sbjct: 439 PHVTHSERLLVCRSLNCQKLSQEACIHAVQNELMPLRTIVQAMFMEQLQS---------- 488 Query: 51 LSHLESNGNPVPFANE 4 H S PVP + E Sbjct: 489 -RHHSSPAPPVPPSGE 503 >XP_002985040.1 hypothetical protein SELMODRAFT_424061 [Selaginella moellendorffii] EFJ13915.1 hypothetical protein SELMODRAFT_424061 [Selaginella moellendorffii] Length = 869 Score = 69.7 bits (169), Expect = 3e-12 Identities = 36/76 (47%), Positives = 47/76 (61%) Frame = -1 Query: 231 PHISPEDRLAVCNFLNCEKLSPEACIHAVQNDLIPLELTVRAMCLQQLQTWRSLKSGCTN 52 PH++ +RL VC LNC+KLS EACIHAVQN+L+PL V+AM ++QLQ+ Sbjct: 562 PHVTHSERLLVCRSLNCQKLSQEACIHAVQNELMPLRTIVQAMFMEQLQS---------- 611 Query: 51 LSHLESNGNPVPFANE 4 H S PVP + E Sbjct: 612 -RHHSSPAPPVPPSGE 626 >XP_007142506.1 hypothetical protein PHAVU_008G286400g [Phaseolus vulgaris] ESW14500.1 hypothetical protein PHAVU_008G286400g [Phaseolus vulgaris] Length = 669 Score = 69.3 bits (168), Expect = 5e-12 Identities = 31/55 (56%), Positives = 44/55 (80%) Frame = -1 Query: 231 PHISPEDRLAVCNFLNCEKLSPEACIHAVQNDLIPLELTVRAMCLQQLQTWRSLK 67 P IS +D++AVC +L+C++LS EACI AVQN+L+PL L V+A+ LQQL T ++ K Sbjct: 442 PGISEDDKVAVCKYLDCQRLSQEACIEAVQNELMPLRLIVQALFLQQLNTHKAFK 496 >XP_010936626.1 PREDICTED: BTB/POZ domain-containing protein At5g48130 [Elaeis guineensis] Length = 690 Score = 68.9 bits (167), Expect = 6e-12 Identities = 30/65 (46%), Positives = 46/65 (70%) Frame = -1 Query: 231 PHISPEDRLAVCNFLNCEKLSPEACIHAVQNDLIPLELTVRAMCLQQLQTWRSLKSGCTN 52 P +S E++ AVC +LNC+KLS E CI AVQNDL+PL L V+A+ +QQL T ++ + + Sbjct: 445 PQLSTEEKAAVCKYLNCQKLSQETCIQAVQNDLMPLRLIVQALFVQQLHTHQAFRDCSDS 504 Query: 51 LSHLE 37 +++ Sbjct: 505 FRYMQ 509 >OAY33018.1 hypothetical protein MANES_13G063200 [Manihot esculenta] Length = 668 Score = 68.6 bits (166), Expect = 9e-12 Identities = 31/55 (56%), Positives = 43/55 (78%) Frame = -1 Query: 231 PHISPEDRLAVCNFLNCEKLSPEACIHAVQNDLIPLELTVRAMCLQQLQTWRSLK 67 P +S E++ AVC +LNC+KLS EACI AVQN+L+PL L V+A+ +QQL T ++ K Sbjct: 442 PDVSQEEKGAVCKYLNCQKLSQEACIEAVQNELMPLRLIVQALFVQQLNTHQAFK 496 >XP_009365236.1 PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein At5g48130 [Pyrus x bretschneideri] Length = 672 Score = 68.6 bits (166), Expect = 9e-12 Identities = 31/55 (56%), Positives = 43/55 (78%) Frame = -1 Query: 231 PHISPEDRLAVCNFLNCEKLSPEACIHAVQNDLIPLELTVRAMCLQQLQTWRSLK 67 P+ S E++ AVC +LNC+KLS EACI AVQN+L+PL L V+A+ +QQL T ++ K Sbjct: 438 PNTSQEEKWAVCKYLNCQKLSQEACIEAVQNELMPLRLIVQALFVQQLSTHQAFK 492 >XP_008342185.1 PREDICTED: BTB/POZ domain-containing protein At5g48130 [Malus domestica] Length = 683 Score = 68.6 bits (166), Expect = 9e-12 Identities = 31/55 (56%), Positives = 43/55 (78%) Frame = -1 Query: 231 PHISPEDRLAVCNFLNCEKLSPEACIHAVQNDLIPLELTVRAMCLQQLQTWRSLK 67 P+ S E++ AVC +LNC+KLS EACI AVQN+L+PL L V+A+ +QQL T ++ K Sbjct: 440 PNTSQEEKWAVCKYLNCQKLSQEACIEAVQNELMPLRLIVQALFVQQLSTHQAFK 494 >KYP48142.1 BTB/POZ domain-containing protein At1g30440 family [Cajanus cajan] Length = 669 Score = 67.8 bits (164), Expect = 2e-11 Identities = 32/60 (53%), Positives = 46/60 (76%) Frame = -1 Query: 231 PHISPEDRLAVCNFLNCEKLSPEACIHAVQNDLIPLELTVRAMCLQQLQTWRSLKSGCTN 52 P IS +D+ AVC +L+C++LS EACI AVQN+L+PL L V+A+ +QQL T ++ K C+N Sbjct: 442 PGISQDDKGAVCKYLDCQRLSQEACIEAVQNELMPLRLIVQALFVQQLNTHKAFKE-CSN 500 >KOM46335.1 hypothetical protein LR48_Vigan07g003900 [Vigna angularis] Length = 647 Score = 67.4 bits (163), Expect = 2e-11 Identities = 31/55 (56%), Positives = 43/55 (78%) Frame = -1 Query: 231 PHISPEDRLAVCNFLNCEKLSPEACIHAVQNDLIPLELTVRAMCLQQLQTWRSLK 67 P IS +D+ AVC +L+C++LS EACI AVQN+L+PL L V+A+ LQQL T ++ K Sbjct: 420 PGISEDDKGAVCKYLDCQRLSQEACIEAVQNELMPLRLIVQALFLQQLNTHKAFK 474 >XP_017429680.1 PREDICTED: BTB/POZ domain-containing protein At5g48130 [Vigna angularis] BAT80513.1 hypothetical protein VIGAN_03010300 [Vigna angularis var. angularis] Length = 669 Score = 67.4 bits (163), Expect = 2e-11 Identities = 31/55 (56%), Positives = 43/55 (78%) Frame = -1 Query: 231 PHISPEDRLAVCNFLNCEKLSPEACIHAVQNDLIPLELTVRAMCLQQLQTWRSLK 67 P IS +D+ AVC +L+C++LS EACI AVQN+L+PL L V+A+ LQQL T ++ K Sbjct: 442 PGISEDDKGAVCKYLDCQRLSQEACIEAVQNELMPLRLIVQALFLQQLNTHKAFK 496 >XP_014504218.1 PREDICTED: BTB/POZ domain-containing protein At5g48130 [Vigna radiata var. radiata] Length = 669 Score = 67.4 bits (163), Expect = 2e-11 Identities = 31/55 (56%), Positives = 43/55 (78%) Frame = -1 Query: 231 PHISPEDRLAVCNFLNCEKLSPEACIHAVQNDLIPLELTVRAMCLQQLQTWRSLK 67 P IS +D+ AVC +L+C++LS EACI AVQN+L+PL L V+A+ LQQL T ++ K Sbjct: 442 PGISEDDKGAVCKYLDCQRLSQEACIEAVQNELMPLRLIVQALFLQQLNTHKAFK 496 >OAE22585.1 hypothetical protein AXG93_731s1280 [Marchantia polymorpha subsp. polymorpha] BAV53286.1 non-phototropic hypocotyl 3-like protein [Marchantia polymorpha] Length = 842 Score = 67.4 bits (163), Expect = 2e-11 Identities = 36/73 (49%), Positives = 45/73 (61%), Gaps = 2/73 (2%) Frame = -1 Query: 231 PHISPEDRLAVCNFLNCEKLSPEACIHAVQNDLIPLELTVRAMCLQQLQTWRSLKSG--C 58 P S E+R VC LNC+KLS E C HAVQN+L+PL + V+AM +QQLQT L + C Sbjct: 525 PQFSQEERQMVCRILNCQKLSQEMCTHAVQNELMPLRMIVQAMFMQQLQTRNVLSANLQC 584 Query: 57 TNLSHLESNGNPV 19 T S N P+ Sbjct: 585 TGGSMRLDNLPPL 597