BLASTX nr result
ID: Ephedra29_contig00025692
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00025692 (277 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KUM45112.1 hypothetical protein ABT39_MTgene4059 (mitochondrion)... 65 4e-10 >KUM45112.1 hypothetical protein ABT39_MTgene4059 (mitochondrion) [Picea glauca] Length = 612 Score = 64.7 bits (156), Expect = 4e-10 Identities = 41/89 (46%), Positives = 51/89 (57%) Frame = -1 Query: 277 HLVDNLPLIHCFTNLDCPLDYLLFTFDVESLYPSIPTSQGLFALNRMLSHFFHHFPMPAS 98 HL D+L L+ P D LL TFDVESLYPSIPT +GL AL MLS + + Sbjct: 260 HLPDSLSLLQVIEAERFPADCLLVTFDVESLYPSIPTQEGLLALRDMLS----QCTVQSF 315 Query: 97 SSHKPG*FIGCILKLANLVLHNHFLEFDG 11 SS + + ++ A LVL HFLEF+G Sbjct: 316 SSEE----VDFLVSAAELVLRWHFLEFNG 340