BLASTX nr result
ID: Ephedra29_contig00025616
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00025616 (296 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008802358.1 PREDICTED: formin-like protein 6 isoform X2 [Phoe... 64 6e-10 XP_008802357.1 PREDICTED: formin-like protein 6 isoform X1 [Phoe... 64 6e-10 XP_010912149.1 PREDICTED: formin-like protein 6 isoform X1 [Elae... 64 6e-10 OAY27481.1 hypothetical protein MANES_16G129100 [Manihot esculenta] 63 2e-09 ERN06514.1 hypothetical protein AMTR_s00058p00080420 [Amborella ... 62 3e-09 XP_010942102.1 PREDICTED: formin-like protein 18 [Elaeis guineen... 62 3e-09 ONI32907.1 hypothetical protein PRUPE_1G393200 [Prunus persica] 62 3e-09 XP_008220680.2 PREDICTED: LOW QUALITY PROTEIN: formin-like prote... 62 3e-09 XP_008357271.1 PREDICTED: LOW QUALITY PROTEIN: formin-like prote... 62 3e-09 XP_006844838.2 PREDICTED: formin-like protein 14 [Amborella tric... 62 3e-09 XP_018833671.1 PREDICTED: formin-like protein 18 isoform X2 [Jug... 62 4e-09 XP_018833670.1 PREDICTED: formin-like protein 18 isoform X1 [Jug... 62 4e-09 XP_006857217.1 PREDICTED: formin-like protein 18 [Amborella tric... 62 6e-09 OAY64470.1 Formin-like protein 6 [Ananas comosus] 61 8e-09 XP_020102864.1 formin-like protein 6 isoform X2 [Ananas comosus] 61 8e-09 XP_011654230.1 PREDICTED: formin-like protein 6 isoform X2 [Cucu... 61 1e-08 GAV83652.1 FH2 domain-containing protein/PTEN_C2 domain-containi... 61 1e-08 XP_008453079.1 PREDICTED: LOW QUALITY PROTEIN: formin-like prote... 61 1e-08 XP_004145586.2 PREDICTED: formin-like protein 18 isoform X1 [Cuc... 61 1e-08 KJB50971.1 hypothetical protein B456_008G1956001, partial [Gossy... 60 1e-08 >XP_008802358.1 PREDICTED: formin-like protein 6 isoform X2 [Phoenix dactylifera] Length = 1056 Score = 64.3 bits (155), Expect = 6e-10 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 93 RPPDGLLEIAERVYVFDSCFSTDVLEEDEYK 1 +PPDGLLEI+ERVYVFDSCF+TDVLEEDEYK Sbjct: 11 KPPDGLLEISERVYVFDSCFTTDVLEEDEYK 41 >XP_008802357.1 PREDICTED: formin-like protein 6 isoform X1 [Phoenix dactylifera] Length = 1253 Score = 64.3 bits (155), Expect = 6e-10 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 93 RPPDGLLEIAERVYVFDSCFSTDVLEEDEYK 1 +PPDGLLEI+ERVYVFDSCF+TDVLEEDEYK Sbjct: 11 KPPDGLLEISERVYVFDSCFTTDVLEEDEYK 41 >XP_010912149.1 PREDICTED: formin-like protein 6 isoform X1 [Elaeis guineensis] Length = 1266 Score = 64.3 bits (155), Expect = 6e-10 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 93 RPPDGLLEIAERVYVFDSCFSTDVLEEDEYK 1 +PPDGLLEI+ERVYVFDSCF+TDVLEEDEYK Sbjct: 11 KPPDGLLEISERVYVFDSCFTTDVLEEDEYK 41 >OAY27481.1 hypothetical protein MANES_16G129100 [Manihot esculenta] Length = 1228 Score = 63.2 bits (152), Expect = 2e-09 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -3 Query: 93 RPPDGLLEIAERVYVFDSCFSTDVLEEDEYK 1 +PPDGLLEI+ERVYVFDSCF+TDVLE+DEYK Sbjct: 11 KPPDGLLEISERVYVFDSCFTTDVLEDDEYK 41 >ERN06514.1 hypothetical protein AMTR_s00058p00080420 [Amborella trichopoda] Length = 852 Score = 62.4 bits (150), Expect = 3e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 93 RPPDGLLEIAERVYVFDSCFSTDVLEEDEYK 1 +PPD LLEI+ERVYVFDSCFSTDVLEEDEYK Sbjct: 11 KPPDRLLEISERVYVFDSCFSTDVLEEDEYK 41 >XP_010942102.1 PREDICTED: formin-like protein 18 [Elaeis guineensis] Length = 1168 Score = 62.4 bits (150), Expect = 3e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 93 RPPDGLLEIAERVYVFDSCFSTDVLEEDEYK 1 +PPDGLLEI+ERVYVFD CFSTDVLEED+YK Sbjct: 11 KPPDGLLEISERVYVFDCCFSTDVLEEDDYK 41 >ONI32907.1 hypothetical protein PRUPE_1G393200 [Prunus persica] Length = 1309 Score = 62.4 bits (150), Expect = 3e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 93 RPPDGLLEIAERVYVFDSCFSTDVLEEDEYK 1 +PPDGLLEI+ERVYVFD CF+TDVLEEDEYK Sbjct: 11 KPPDGLLEISERVYVFDCCFTTDVLEEDEYK 41 >XP_008220680.2 PREDICTED: LOW QUALITY PROTEIN: formin-like protein 18 [Prunus mume] Length = 1335 Score = 62.4 bits (150), Expect = 3e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 93 RPPDGLLEIAERVYVFDSCFSTDVLEEDEYK 1 +PPDGLLEI+ERVYVFD CF+TDVLEEDEYK Sbjct: 11 KPPDGLLEISERVYVFDCCFTTDVLEEDEYK 41 >XP_008357271.1 PREDICTED: LOW QUALITY PROTEIN: formin-like protein 6 [Malus domestica] Length = 1485 Score = 62.4 bits (150), Expect = 3e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 93 RPPDGLLEIAERVYVFDSCFSTDVLEEDEYK 1 +PPDGLLEI+ERVYVFD CF+TDVLEEDEYK Sbjct: 11 KPPDGLLEISERVYVFDCCFTTDVLEEDEYK 41 >XP_006844838.2 PREDICTED: formin-like protein 14 [Amborella trichopoda] Length = 1581 Score = 62.4 bits (150), Expect = 3e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 93 RPPDGLLEIAERVYVFDSCFSTDVLEEDEYK 1 +PPD LLEI+ERVYVFDSCFSTDVLEEDEYK Sbjct: 11 KPPDRLLEISERVYVFDSCFSTDVLEEDEYK 41 >XP_018833671.1 PREDICTED: formin-like protein 18 isoform X2 [Juglans regia] Length = 1177 Score = 62.0 bits (149), Expect = 4e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 93 RPPDGLLEIAERVYVFDSCFSTDVLEEDEYK 1 +PPDGLLEI+ERVYVFDSCF+TDV EEDEYK Sbjct: 11 KPPDGLLEISERVYVFDSCFTTDVWEEDEYK 41 >XP_018833670.1 PREDICTED: formin-like protein 18 isoform X1 [Juglans regia] Length = 1314 Score = 62.0 bits (149), Expect = 4e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 93 RPPDGLLEIAERVYVFDSCFSTDVLEEDEYK 1 +PPDGLLEI+ERVYVFDSCF+TDV EEDEYK Sbjct: 11 KPPDGLLEISERVYVFDSCFTTDVWEEDEYK 41 >XP_006857217.1 PREDICTED: formin-like protein 18 [Amborella trichopoda] ERN18684.1 hypothetical protein AMTR_s00065p00203330 [Amborella trichopoda] Length = 1262 Score = 61.6 bits (148), Expect = 6e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 93 RPPDGLLEIAERVYVFDSCFSTDVLEEDEYK 1 +PPDGLLEI+ERVYVFD CFSTDVLEE+EYK Sbjct: 11 KPPDGLLEISERVYVFDCCFSTDVLEENEYK 41 >OAY64470.1 Formin-like protein 6 [Ananas comosus] Length = 1407 Score = 61.2 bits (147), Expect = 8e-09 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 93 RPPDGLLEIAERVYVFDSCFSTDVLEEDEYK 1 +PPDGLLEI+ERVYVFD CF+TDVLE+DEYK Sbjct: 11 KPPDGLLEISERVYVFDCCFTTDVLEDDEYK 41 >XP_020102864.1 formin-like protein 6 isoform X2 [Ananas comosus] Length = 1412 Score = 61.2 bits (147), Expect = 8e-09 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 93 RPPDGLLEIAERVYVFDSCFSTDVLEEDEYK 1 +PPDGLLEI+ERVYVFD CF+TDVLE+DEYK Sbjct: 11 KPPDGLLEISERVYVFDCCFTTDVLEDDEYK 41 >XP_011654230.1 PREDICTED: formin-like protein 6 isoform X2 [Cucumis sativus] Length = 1211 Score = 60.8 bits (146), Expect = 1e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 93 RPPDGLLEIAERVYVFDSCFSTDVLEEDEYK 1 +PPDGLLEI+ERVYVFD CF+T+VLEEDEYK Sbjct: 11 KPPDGLLEISERVYVFDCCFTTEVLEEDEYK 41 >GAV83652.1 FH2 domain-containing protein/PTEN_C2 domain-containing protein [Cephalotus follicularis] Length = 1255 Score = 60.8 bits (146), Expect = 1e-08 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -3 Query: 93 RPPDGLLEIAERVYVFDSCFSTDVLEEDEYK 1 +PPDGLLEI+ERVYVFD CF+TD+LE+DEYK Sbjct: 11 KPPDGLLEISERVYVFDCCFTTDILEDDEYK 41 >XP_008453079.1 PREDICTED: LOW QUALITY PROTEIN: formin-like protein 18 [Cucumis melo] Length = 1283 Score = 60.8 bits (146), Expect = 1e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 93 RPPDGLLEIAERVYVFDSCFSTDVLEEDEYK 1 +PPDGLLEI+ERVYVFD CF+T+VLEEDEYK Sbjct: 11 KPPDGLLEISERVYVFDCCFTTEVLEEDEYK 41 >XP_004145586.2 PREDICTED: formin-like protein 18 isoform X1 [Cucumis sativus] KGN55433.1 hypothetical protein Csa_4G651990 [Cucumis sativus] Length = 1416 Score = 60.8 bits (146), Expect = 1e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 93 RPPDGLLEIAERVYVFDSCFSTDVLEEDEYK 1 +PPDGLLEI+ERVYVFD CF+T+VLEEDEYK Sbjct: 11 KPPDGLLEISERVYVFDCCFTTEVLEEDEYK 41 >KJB50971.1 hypothetical protein B456_008G1956001, partial [Gossypium raimondii] KJB50972.1 hypothetical protein B456_008G1956001, partial [Gossypium raimondii] KJB50973.1 hypothetical protein B456_008G1956001, partial [Gossypium raimondii] KJB50974.1 hypothetical protein B456_008G1956001, partial [Gossypium raimondii] Length = 661 Score = 60.5 bits (145), Expect = 1e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 93 RPPDGLLEIAERVYVFDSCFSTDVLEEDEYK 1 +PPD LLEI+ERVYVFD CFSTDVLEEDEYK Sbjct: 11 KPPDRLLEISERVYVFDCCFSTDVLEEDEYK 41