BLASTX nr result
ID: Ephedra29_contig00025568
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00025568 (266 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAE23428.1 hypothetical protein AXG93_961s1250 [Marchantia polym... 57 2e-07 >OAE23428.1 hypothetical protein AXG93_961s1250 [Marchantia polymorpha subsp. polymorpha] Length = 1874 Score = 56.6 bits (135), Expect = 2e-07 Identities = 27/61 (44%), Positives = 36/61 (59%) Frame = +1 Query: 82 EETYLQVXXXXXXXXAFLNSGNGTEVQYLCLLYQMTFSVKLDVYELGFSSIEDLINNWSD 261 E+ LQ AF NSG+G EV +LC LY+ TF +D+ LGFSS+ +L +W D Sbjct: 898 EDEILQARLRIRILLAFHNSGHGVEVSHLCELYEATFKASIDLQLLGFSSVLELARSWHD 957 Query: 262 I 264 I Sbjct: 958 I 958