BLASTX nr result
ID: Ephedra29_contig00025467
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00025467 (231 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010273294.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 2e-11 XP_011623560.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 3e-10 XP_018816431.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 5e-10 XP_015573744.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 63 7e-10 CBI15196.3 unnamed protein product, partial [Vitis vinifera] 63 9e-10 XP_002281803.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 9e-10 XP_002303270.2 pentatricopeptide repeat-containing family protei... 63 9e-10 XP_011039995.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 9e-10 XP_010264131.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 1e-09 XP_013444656.1 pentatricopeptide (PPR) repeat protein [Medicago ... 62 1e-09 XP_018470380.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 2e-09 XP_006306315.1 hypothetical protein CARUB_v10012185mg [Capsella ... 62 2e-09 KZM80711.1 hypothetical protein DCAR_032307 [Daucus carota subsp... 62 2e-09 CDP12844.1 unnamed protein product [Coffea canephora] 62 2e-09 ADE75673.1 unknown [Picea sitchensis] 61 2e-09 XP_016652176.1 PREDICTED: putative pentatricopeptide repeat-cont... 61 3e-09 XP_008243706.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 3e-09 XP_011094314.1 PREDICTED: putative pentatricopeptide repeat-cont... 61 3e-09 CAN66661.1 hypothetical protein VITISV_031721, partial [Vitis vi... 61 4e-09 XP_008342860.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 4e-09 >XP_010273294.1 PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic [Nelumbo nucifera] Length = 874 Score = 67.8 bits (164), Expect = 2e-11 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = +3 Query: 3 GYLDEAHRLIECMPIKPDPGIWCALLNACKIHKNTQLAEYVERTQFRADSDT 158 GYL++AH IE MP+KPDP IW ALLNAC+IH+ +L E R F DS++ Sbjct: 648 GYLEDAHEFIEKMPLKPDPAIWGALLNACRIHRKLELGELAARFVFEMDSES 699 >XP_011623560.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Amborella trichopoda] Length = 737 Score = 64.3 bits (155), Expect = 3e-10 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 5/77 (6%) Frame = +3 Query: 3 GYLDEAHRLIECMPIKPDPGIWCALLNACKIHKNTQLAEYVERTQFRADSDT*ATLYCLQ 182 G+LDEAH LI+ MP KP+ G+W ALL AC+IH NT++ EY + FR + + A Y L Sbjct: 516 GHLDEAHELIKQMPSKPNDGVWGALLGACRIHGNTRIGEYAAQNLFRIEPEH-AGYYVLM 574 Query: 183 RFI-----HLQEGGQMQ 218 I H +E G+++ Sbjct: 575 SNIYAASNHWEEVGKLR 591 >XP_018816431.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Juglans regia] XP_018816432.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Juglans regia] XP_018816433.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Juglans regia] XP_018816434.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Juglans regia] XP_018816435.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Juglans regia] Length = 703 Score = 63.5 bits (153), Expect = 5e-10 Identities = 33/68 (48%), Positives = 42/68 (61%) Frame = +3 Query: 3 GYLDEAHRLIECMPIKPDPGIWCALLNACKIHKNTQLAEYVERTQFRADSDT*ATLYCLQ 182 G L+EAH IE MP+ PD G+W ALL AC+IH N +LAE ++ FR DSD Y L Sbjct: 482 GRLNEAHDFIERMPMWPDAGVWGALLGACRIHLNVELAEVAAKSLFRLDSDN-TGRYVLL 540 Query: 183 RFIHLQEG 206 I++ G Sbjct: 541 SNIYVSSG 548 >XP_015573744.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g15510, chloroplastic [Ricinus communis] Length = 884 Score = 63.2 bits (152), Expect = 7e-10 Identities = 27/52 (51%), Positives = 36/52 (69%) Frame = +3 Query: 3 GYLDEAHRLIECMPIKPDPGIWCALLNACKIHKNTQLAEYVERTQFRADSDT 158 G L EAH IE MPIKPDP IW ALLNAC++H+ L E+ + F+ D+++ Sbjct: 654 GKLKEAHEFIEKMPIKPDPAIWGALLNACRMHRQVHLGEFAAQKIFKEDTES 705 >CBI15196.3 unnamed protein product, partial [Vitis vinifera] Length = 467 Score = 62.8 bits (151), Expect = 9e-10 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = +3 Query: 3 GYLDEAHRLIECMPIKPDPGIWCALLNACKIHKNTQLAEYV 125 G+LDEAHRLIE MP+KP+ +W ALL C+IHKN +LA +V Sbjct: 323 GFLDEAHRLIESMPMKPNDAVWGALLGGCRIHKNAELASHV 363 >XP_002281803.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Length = 553 Score = 62.8 bits (151), Expect = 9e-10 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = +3 Query: 3 GYLDEAHRLIECMPIKPDPGIWCALLNACKIHKNTQLAEYV 125 G+LDEAHRLIE MP+KP+ +W ALL C+IHKN +LA +V Sbjct: 409 GFLDEAHRLIESMPMKPNDAVWGALLGGCRIHKNAELASHV 449 >XP_002303270.2 pentatricopeptide repeat-containing family protein [Populus trichocarpa] EEE78249.2 pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 786 Score = 62.8 bits (151), Expect = 9e-10 Identities = 28/52 (53%), Positives = 37/52 (71%) Frame = +3 Query: 3 GYLDEAHRLIECMPIKPDPGIWCALLNACKIHKNTQLAEYVERTQFRADSDT 158 G L+EAH IE MPIKPDP IW ALLNAC+IH++ L E + F+ D+++ Sbjct: 564 GKLNEAHEFIERMPIKPDPAIWGALLNACRIHRHVLLGELAAQHIFKQDAES 615 >XP_011039995.1 PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic [Populus euphratica] Length = 878 Score = 62.8 bits (151), Expect = 9e-10 Identities = 28/52 (53%), Positives = 37/52 (71%) Frame = +3 Query: 3 GYLDEAHRLIECMPIKPDPGIWCALLNACKIHKNTQLAEYVERTQFRADSDT 158 G L+EAH IE MPIKPDP IW ALLNAC+IH++ L E + F+ D+++ Sbjct: 656 GKLNEAHEFIERMPIKPDPAIWGALLNACRIHRHVLLGELAAQHIFKEDAES 707 >XP_010264131.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic [Nelumbo nucifera] Length = 621 Score = 62.4 bits (150), Expect = 1e-09 Identities = 28/51 (54%), Positives = 34/51 (66%) Frame = +3 Query: 3 GYLDEAHRLIECMPIKPDPGIWCALLNACKIHKNTQLAEYVERTQFRADSD 155 G L EA IE MPIKPD G+W ALL AC+IH N +LAE ++ F DS+ Sbjct: 400 GQLSEAQEFIESMPIKPDSGVWGALLGACRIHLNVELAELAAKSLFELDSE 450 >XP_013444656.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH18681.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 967 Score = 62.4 bits (150), Expect = 1e-09 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = +3 Query: 3 GYLDEAHRLIECMPIKPDPGIWCALLNACKIHKNTQLAEYVERTQFRAD 149 G+LDEA IE MPIKPD IW ALL +CKIHKN +LAE R F+ + Sbjct: 716 GFLDEASHFIETMPIKPDASIWGALLASCKIHKNIKLAEIAARKLFKME 764 >XP_018470380.1 PREDICTED: pentatricopeptide repeat-containing protein At4g30700 [Raphanus sativus] Length = 793 Score = 62.0 bits (149), Expect = 2e-09 Identities = 27/51 (52%), Positives = 33/51 (64%) Frame = +3 Query: 3 GYLDEAHRLIECMPIKPDPGIWCALLNACKIHKNTQLAEYVERTQFRADSD 155 GYL+ A + IE MP++PDP +W LL ACKIHK+T LA V F D D Sbjct: 572 GYLERALQFIEAMPVEPDPSVWQTLLGACKIHKDTNLARAVSEKLFELDPD 622 >XP_006306315.1 hypothetical protein CARUB_v10012185mg [Capsella rubella] EOA39213.1 hypothetical protein CARUB_v10012185mg [Capsella rubella] Length = 866 Score = 62.0 bits (149), Expect = 2e-09 Identities = 26/52 (50%), Positives = 35/52 (67%) Frame = +3 Query: 3 GYLDEAHRLIECMPIKPDPGIWCALLNACKIHKNTQLAEYVERTQFRADSDT 158 G L+EAH+ I+ MP+ PDP +W ALLNAC+IH+N L E + F D D+ Sbjct: 647 GELEEAHKFIQKMPVTPDPAVWGALLNACRIHRNIDLGELSAQRIFELDKDS 698 >KZM80711.1 hypothetical protein DCAR_032307 [Daucus carota subsp. sativus] Length = 437 Score = 61.6 bits (148), Expect = 2e-09 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = +3 Query: 3 GYLDEAHRLIECMPIKPDPGIWCALLNACKIHKNTQLAEYVERTQFRA 146 G+LDEAHRLI MP+KP+ +W ALL CKIHKN +LA V RA Sbjct: 312 GHLDEAHRLIMSMPMKPNDAVWGALLGGCKIHKNAELASLVAEKLIRA 359 >CDP12844.1 unnamed protein product [Coffea canephora] Length = 651 Score = 61.6 bits (148), Expect = 2e-09 Identities = 27/49 (55%), Positives = 32/49 (65%) Frame = +3 Query: 3 GYLDEAHRLIECMPIKPDPGIWCALLNACKIHKNTQLAEYVERTQFRAD 149 G L EA I+CMPIKPD GIW ALL+ACKIH+N + EY F + Sbjct: 513 GKLKEALEYIQCMPIKPDAGIWAALLSACKIHRNADIGEYAAHHLFELE 561 >ADE75673.1 unknown [Picea sitchensis] Length = 246 Score = 60.8 bits (146), Expect = 2e-09 Identities = 28/51 (54%), Positives = 35/51 (68%) Frame = +3 Query: 3 GYLDEAHRLIECMPIKPDPGIWCALLNACKIHKNTQLAEYVERTQFRADSD 155 G LDEAH I MP++PD G+W ALL ACKIH N +LAE V F+ +S+ Sbjct: 25 GCLDEAHDFISNMPLEPDDGVWGALLGACKIHLNIELAECVAEHLFKLESE 75 >XP_016652176.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460 isoform X2 [Prunus mume] Length = 503 Score = 61.2 bits (147), Expect = 3e-09 Identities = 31/66 (46%), Positives = 42/66 (63%) Frame = +3 Query: 3 GYLDEAHRLIECMPIKPDPGIWCALLNACKIHKNTQLAEYVERTQFRADSDT*ATLYCLQ 182 G L EA++ IE MP++PD G+W ALL+AC+IH N +LAE V R D+ T T Y L Sbjct: 408 GCLHEAYKFIETMPVEPDAGVWGALLSACRIHGNVELAELVVARLSRLDTQT-VTSYVLM 466 Query: 183 RFIHLQ 200 I+ + Sbjct: 467 SNIYAE 472 >XP_008243706.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like isoform X1 [Prunus mume] Length = 577 Score = 61.2 bits (147), Expect = 3e-09 Identities = 31/66 (46%), Positives = 42/66 (63%) Frame = +3 Query: 3 GYLDEAHRLIECMPIKPDPGIWCALLNACKIHKNTQLAEYVERTQFRADSDT*ATLYCLQ 182 G L EA++ IE MP++PD G+W ALL+AC+IH N +LAE V R D+ T T Y L Sbjct: 482 GCLHEAYKFIETMPVEPDAGVWGALLSACRIHGNVELAELVVARLSRLDTQT-VTSYVLM 540 Query: 183 RFIHLQ 200 I+ + Sbjct: 541 SNIYAE 546 >XP_011094314.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460 [Sesamum indicum] Length = 634 Score = 61.2 bits (147), Expect = 3e-09 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = +3 Query: 3 GYLDEAHRLIECMPIKPDPGIWCALLNACKIHKNTQLAE 119 G LDEAH LIE MPI+PD +W ALL ACKIHKN LAE Sbjct: 418 GRLDEAHNLIEAMPIEPDGPVWGALLGACKIHKNVDLAE 456 >CAN66661.1 hypothetical protein VITISV_031721, partial [Vitis vinifera] Length = 569 Score = 60.8 bits (146), Expect = 4e-09 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +3 Query: 3 GYLDEAHRLIECMPIKPDPGIWCALLNACKIHKNTQLAEYV 125 G+LDEAHRL E MP+KP+ +W ALL C+IHKN +LA +V Sbjct: 425 GFLDEAHRLXESMPMKPNDAVWGALLGGCRIHKNAELASHV 465 >XP_008342860.1 PREDICTED: pentatricopeptide repeat-containing protein At4g19191, mitochondrial [Malus domestica] Length = 680 Score = 60.8 bits (146), Expect = 4e-09 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = +3 Query: 3 GYLDEAHRLIECMPIKPDPGIWCALLNACKIHKNTQLAEYVERTQFRADSD 155 G L EA L+E MP+KPD GIW ALL+ACKIH+N ++ EY F + D Sbjct: 539 GRLKEAVELVESMPVKPDAGIWSALLSACKIHRNVEMGEYACGRLFELEPD 589