BLASTX nr result
ID: Ephedra29_contig00025446
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00025446 (293 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011027852.1 PREDICTED: allantoinase [Populus euphratica] XP_0... 75 1e-13 XP_002305806.2 hypothetical protein POPTR_0004s04190g [Populus t... 74 2e-13 XP_020080038.1 uncharacterized protein LOC109703725 [Ananas como... 74 2e-13 KHN08534.1 Putative allantoinase 1 [Glycine soja] 74 3e-13 XP_003543054.1 PREDICTED: allantoinase-like [Glycine max] KRH214... 74 3e-13 ERM95197.1 hypothetical protein AMTR_s00009p00265610 [Amborella ... 73 4e-13 XP_011625481.1 PREDICTED: probable allantoinase [Amborella trich... 73 4e-13 GAV77921.1 Amidohydro_1 domain-containing protein [Cephalotus fo... 73 4e-13 KRH10855.1 hypothetical protein GLYMA_15G073000 [Glycine max] 72 8e-13 XP_006597425.1 PREDICTED: allantoinase-like isoform X3 [Glycine ... 72 8e-13 XP_003545922.1 PREDICTED: allantoinase-like isoform X2 [Glycine ... 72 8e-13 XP_014623487.1 PREDICTED: allantoinase-like isoform X1 [Glycine ... 72 8e-13 KRH10854.1 hypothetical protein GLYMA_15G073000 [Glycine max] 72 8e-13 JAT51525.1 Allantoinase [Anthurium amnicola] 71 1e-12 XP_012091586.1 PREDICTED: allantoinase isoform X2 [Jatropha curcas] 71 2e-12 XP_012091585.1 PREDICTED: allantoinase isoform X1 [Jatropha curc... 71 2e-12 JAT47676.1 Allantoinase [Anthurium amnicola] JAT48599.1 Allantoi... 71 2e-12 XP_002519047.1 PREDICTED: allantoinase isoform X2 [Ricinus commu... 71 3e-12 XP_015574653.1 PREDICTED: allantoinase isoform X1 [Ricinus commu... 71 3e-12 XP_013671908.1 PREDICTED: allantoinase-like isoform X2 [Brassica... 70 4e-12 >XP_011027852.1 PREDICTED: allantoinase [Populus euphratica] XP_011027853.1 PREDICTED: allantoinase [Populus euphratica] XP_011027854.1 PREDICTED: allantoinase [Populus euphratica] XP_011027855.1 PREDICTED: allantoinase [Populus euphratica] Length = 504 Score = 74.7 bits (182), Expect = 1e-13 Identities = 36/54 (66%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = +3 Query: 3 INKDYTVYHRH-SITAYEGRKLSGKVISTFVRGNLVYEKGQHASSMCGSPILAT 161 +N D VY +H SI+AY G KLSGKV++TFVRGNLVY++G+HA + CGSPILAT Sbjct: 451 LNNDLPVYLKHPSISAYMGSKLSGKVLATFVRGNLVYKEGKHAPAACGSPILAT 504 >XP_002305806.2 hypothetical protein POPTR_0004s04190g [Populus trichocarpa] EEE86317.2 hypothetical protein POPTR_0004s04190g [Populus trichocarpa] Length = 504 Score = 74.3 bits (181), Expect = 2e-13 Identities = 36/54 (66%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = +3 Query: 3 INKDYTVYHRH-SITAYEGRKLSGKVISTFVRGNLVYEKGQHASSMCGSPILAT 161 +N D VY +H SI+AY G KLSGKV+STFVRGNLVY++G+HA + CG+PILAT Sbjct: 451 LNNDLPVYLKHPSISAYMGSKLSGKVMSTFVRGNLVYKEGKHAPAACGAPILAT 504 >XP_020080038.1 uncharacterized protein LOC109703725 [Ananas comosus] Length = 1477 Score = 74.3 bits (181), Expect = 2e-13 Identities = 32/53 (60%), Positives = 47/53 (88%), Gaps = 1/53 (1%) Frame = +3 Query: 3 INKDYTVYHRH-SITAYEGRKLSGKVISTFVRGNLVYEKGQHASSMCGSPILA 158 +N+++T+YH+H +I+AY G++LSGKV++TFVRGNLVY +G+HA + CG PILA Sbjct: 468 LNENHTIYHKHPNISAYVGKRLSGKVLATFVRGNLVYTEGKHAPAACGVPILA 520 >KHN08534.1 Putative allantoinase 1 [Glycine soja] Length = 512 Score = 73.6 bits (179), Expect = 3e-13 Identities = 34/53 (64%), Positives = 45/53 (84%), Gaps = 1/53 (1%) Frame = +3 Query: 3 INKDYTVYHRH-SITAYEGRKLSGKVISTFVRGNLVYEKGQHASSMCGSPILA 158 +N+DY V+ +H S++AY GR+LSGKV+ TFVRGNLV++KG+HA S CG PILA Sbjct: 459 LNEDYPVFLKHPSLSAYMGRRLSGKVLETFVRGNLVFKKGKHAPSACGVPILA 511 >XP_003543054.1 PREDICTED: allantoinase-like [Glycine max] KRH21460.1 hypothetical protein GLYMA_13G240500 [Glycine max] KRH21461.1 hypothetical protein GLYMA_13G240500 [Glycine max] Length = 512 Score = 73.6 bits (179), Expect = 3e-13 Identities = 34/53 (64%), Positives = 45/53 (84%), Gaps = 1/53 (1%) Frame = +3 Query: 3 INKDYTVYHRH-SITAYEGRKLSGKVISTFVRGNLVYEKGQHASSMCGSPILA 158 +N+DY V+ +H S++AY GR+LSGKV+ TFVRGNLV++KG+HA S CG PILA Sbjct: 459 LNEDYPVFLKHPSLSAYMGRRLSGKVLETFVRGNLVFKKGKHAPSACGVPILA 511 >ERM95197.1 hypothetical protein AMTR_s00009p00265610 [Amborella trichopoda] Length = 490 Score = 73.2 bits (178), Expect = 4e-13 Identities = 28/52 (53%), Positives = 43/52 (82%) Frame = +3 Query: 3 INKDYTVYHRHSITAYEGRKLSGKVISTFVRGNLVYEKGQHASSMCGSPILA 158 ++++Y +YH+H +T Y G+++ GKV++TFVRGNLVY +G+HA + CG PILA Sbjct: 438 LDENYNIYHKHPVTPYMGKQMHGKVLATFVRGNLVYREGEHAPAACGIPILA 489 >XP_011625481.1 PREDICTED: probable allantoinase [Amborella trichopoda] Length = 492 Score = 73.2 bits (178), Expect = 4e-13 Identities = 28/52 (53%), Positives = 43/52 (82%) Frame = +3 Query: 3 INKDYTVYHRHSITAYEGRKLSGKVISTFVRGNLVYEKGQHASSMCGSPILA 158 ++++Y +YH+H +T Y G+++ GKV++TFVRGNLVY +G+HA + CG PILA Sbjct: 440 LDENYNIYHKHPVTPYMGKQMHGKVLATFVRGNLVYREGEHAPAACGIPILA 491 >GAV77921.1 Amidohydro_1 domain-containing protein [Cephalotus follicularis] Length = 506 Score = 73.2 bits (178), Expect = 4e-13 Identities = 33/54 (61%), Positives = 47/54 (87%), Gaps = 1/54 (1%) Frame = +3 Query: 3 INKDYTVYHRH-SITAYEGRKLSGKVISTFVRGNLVYEKGQHASSMCGSPILAT 161 +N D+ ++ +H SI+AY G++LSGKV++TFVRGNLVYE+G+HA + CG+PILAT Sbjct: 453 LNADHPIHLKHPSISAYLGKRLSGKVLATFVRGNLVYEEGKHAPAACGTPILAT 506 >KRH10855.1 hypothetical protein GLYMA_15G073000 [Glycine max] Length = 410 Score = 72.4 bits (176), Expect = 8e-13 Identities = 33/53 (62%), Positives = 45/53 (84%), Gaps = 1/53 (1%) Frame = +3 Query: 3 INKDYTVYHRH-SITAYEGRKLSGKVISTFVRGNLVYEKGQHASSMCGSPILA 158 +N+DY V+ +H S++AY GR+LSGKV+ TFVRGNLV++KG+HA + CG PILA Sbjct: 357 LNEDYPVFLKHPSLSAYMGRRLSGKVLETFVRGNLVFKKGKHAHAACGVPILA 409 >XP_006597425.1 PREDICTED: allantoinase-like isoform X3 [Glycine max] Length = 475 Score = 72.4 bits (176), Expect = 8e-13 Identities = 33/53 (62%), Positives = 45/53 (84%), Gaps = 1/53 (1%) Frame = +3 Query: 3 INKDYTVYHRH-SITAYEGRKLSGKVISTFVRGNLVYEKGQHASSMCGSPILA 158 +N+DY V+ +H S++AY GR+LSGKV+ TFVRGNLV++KG+HA + CG PILA Sbjct: 422 LNEDYPVFLKHPSLSAYMGRRLSGKVLETFVRGNLVFKKGKHAHAACGVPILA 474 >XP_003545922.1 PREDICTED: allantoinase-like isoform X2 [Glycine max] Length = 512 Score = 72.4 bits (176), Expect = 8e-13 Identities = 33/53 (62%), Positives = 45/53 (84%), Gaps = 1/53 (1%) Frame = +3 Query: 3 INKDYTVYHRH-SITAYEGRKLSGKVISTFVRGNLVYEKGQHASSMCGSPILA 158 +N+DY V+ +H S++AY GR+LSGKV+ TFVRGNLV++KG+HA + CG PILA Sbjct: 459 LNEDYPVFLKHPSLSAYMGRRLSGKVLETFVRGNLVFKKGKHAHAACGVPILA 511 >XP_014623487.1 PREDICTED: allantoinase-like isoform X1 [Glycine max] XP_014623488.1 PREDICTED: allantoinase-like isoform X1 [Glycine max] Length = 515 Score = 72.4 bits (176), Expect = 8e-13 Identities = 33/53 (62%), Positives = 45/53 (84%), Gaps = 1/53 (1%) Frame = +3 Query: 3 INKDYTVYHRH-SITAYEGRKLSGKVISTFVRGNLVYEKGQHASSMCGSPILA 158 +N+DY V+ +H S++AY GR+LSGKV+ TFVRGNLV++KG+HA + CG PILA Sbjct: 462 LNEDYPVFLKHPSLSAYMGRRLSGKVLETFVRGNLVFKKGKHAHAACGVPILA 514 >KRH10854.1 hypothetical protein GLYMA_15G073000 [Glycine max] Length = 522 Score = 72.4 bits (176), Expect = 8e-13 Identities = 33/53 (62%), Positives = 45/53 (84%), Gaps = 1/53 (1%) Frame = +3 Query: 3 INKDYTVYHRH-SITAYEGRKLSGKVISTFVRGNLVYEKGQHASSMCGSPILA 158 +N+DY V+ +H S++AY GR+LSGKV+ TFVRGNLV++KG+HA + CG PILA Sbjct: 469 LNEDYPVFLKHPSLSAYMGRRLSGKVLETFVRGNLVFKKGKHAHAACGVPILA 521 >JAT51525.1 Allantoinase [Anthurium amnicola] Length = 311 Score = 71.2 bits (173), Expect = 1e-12 Identities = 31/55 (56%), Positives = 45/55 (81%), Gaps = 1/55 (1%) Frame = +3 Query: 3 INKDYTVYHRH-SITAYEGRKLSGKVISTFVRGNLVYEKGQHASSMCGSPILATR 164 +++ Y YH+H +I+AY G +LSG+V++TFVRGNLVY KG+HA++ CG PILA + Sbjct: 257 LDESYNTYHKHPNISAYMGTRLSGEVLATFVRGNLVYSKGKHATAACGIPILAKK 311 >XP_012091586.1 PREDICTED: allantoinase isoform X2 [Jatropha curcas] Length = 442 Score = 71.2 bits (173), Expect = 2e-12 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 1/53 (1%) Frame = +3 Query: 3 INKDYTVYHRH-SITAYEGRKLSGKVISTFVRGNLVYEKGQHASSMCGSPILA 158 +N D +Y +H SI+AY G KLSGKV++TFVRGNLVY++G+HAS+ CGS ILA Sbjct: 389 LNNDLPIYFKHPSISAYMGTKLSGKVLATFVRGNLVYKEGKHASAACGSLILA 441 >XP_012091585.1 PREDICTED: allantoinase isoform X1 [Jatropha curcas] KDP20954.1 hypothetical protein JCGZ_21425 [Jatropha curcas] Length = 503 Score = 71.2 bits (173), Expect = 2e-12 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 1/53 (1%) Frame = +3 Query: 3 INKDYTVYHRH-SITAYEGRKLSGKVISTFVRGNLVYEKGQHASSMCGSPILA 158 +N D +Y +H SI+AY G KLSGKV++TFVRGNLVY++G+HAS+ CGS ILA Sbjct: 450 LNNDLPIYFKHPSISAYMGTKLSGKVLATFVRGNLVYKEGKHASAACGSLILA 502 >JAT47676.1 Allantoinase [Anthurium amnicola] JAT48599.1 Allantoinase [Anthurium amnicola] JAT56504.1 Allantoinase [Anthurium amnicola] Length = 504 Score = 71.2 bits (173), Expect = 2e-12 Identities = 31/55 (56%), Positives = 45/55 (81%), Gaps = 1/55 (1%) Frame = +3 Query: 3 INKDYTVYHRH-SITAYEGRKLSGKVISTFVRGNLVYEKGQHASSMCGSPILATR 164 +++ Y YH+H +I+AY G +LSG+V++TFVRGNLVY KG+HA++ CG PILA + Sbjct: 450 LDESYNTYHKHPNISAYMGTRLSGEVLATFVRGNLVYSKGKHATAACGIPILAKK 504 >XP_002519047.1 PREDICTED: allantoinase isoform X2 [Ricinus communis] EEF43258.1 allantoinase, putative [Ricinus communis] Length = 500 Score = 70.9 bits (172), Expect = 3e-12 Identities = 33/53 (62%), Positives = 44/53 (83%), Gaps = 1/53 (1%) Frame = +3 Query: 3 INKDYTVYHRHS-ITAYEGRKLSGKVISTFVRGNLVYEKGQHASSMCGSPILA 158 ++ D +Y +HS I+AY+G KLSGKV++TFVRGNLVY +G+HA + CGSPILA Sbjct: 447 LSDDLPIYIKHSSISAYKGTKLSGKVLATFVRGNLVYREGKHAPTACGSPILA 499 >XP_015574653.1 PREDICTED: allantoinase isoform X1 [Ricinus communis] Length = 501 Score = 70.9 bits (172), Expect = 3e-12 Identities = 33/53 (62%), Positives = 44/53 (83%), Gaps = 1/53 (1%) Frame = +3 Query: 3 INKDYTVYHRHS-ITAYEGRKLSGKVISTFVRGNLVYEKGQHASSMCGSPILA 158 ++ D +Y +HS I+AY+G KLSGKV++TFVRGNLVY +G+HA + CGSPILA Sbjct: 448 LSDDLPIYIKHSSISAYKGTKLSGKVLATFVRGNLVYREGKHAPTACGSPILA 500 >XP_013671908.1 PREDICTED: allantoinase-like isoform X2 [Brassica napus] Length = 503 Score = 70.5 bits (171), Expect = 4e-12 Identities = 33/54 (61%), Positives = 46/54 (85%), Gaps = 1/54 (1%) Frame = +3 Query: 3 INKDYTVYHRH-SITAYEGRKLSGKVISTFVRGNLVYEKGQHASSMCGSPILAT 161 +++D+ ++ +H SI+AY GRKLSGKV+STFVRGNLV+ +G+HAS CGS +LAT Sbjct: 450 LDEDHPIHFKHPSISAYLGRKLSGKVVSTFVRGNLVFGEGKHASDACGSLLLAT 503