BLASTX nr result
ID: Ephedra29_contig00025428
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00025428 (250 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017701890.1 PREDICTED: uncharacterized protein LOC103722074 [... 54 1e-06 XP_010269355.1 PREDICTED: microtubule-associated protein RP/EB f... 52 7e-06 >XP_017701890.1 PREDICTED: uncharacterized protein LOC103722074 [Phoenix dactylifera] Length = 436 Score = 54.3 bits (129), Expect = 1e-06 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 7/47 (14%) Frame = -3 Query: 230 VTPAPQKP-----VKRRCLRALFLES--SDDEDGKKPIRHGCRLQCQ 111 +TPA QKP ++RRCLRALF+ES SD E +KP RHGCR C+ Sbjct: 359 ITPADQKPSHEPRIRRRCLRALFMESSESDPEKPQKPRRHGCRFNCE 405 >XP_010269355.1 PREDICTED: microtubule-associated protein RP/EB family member 1-like [Nelumbo nucifera] Length = 497 Score = 52.0 bits (123), Expect = 7e-06 Identities = 25/47 (53%), Positives = 31/47 (65%), Gaps = 2/47 (4%) Frame = -3 Query: 248 ETQAIHVTPAPQKPVKRRCLRALFLESSDD--EDGKKPIRHGCRLQC 114 E ++ APQ V+RRCLRALF+ESSD ++ KP RHGCR C Sbjct: 435 EEDKANLNTAPQPVVRRRCLRALFMESSDSDPDNPNKPRRHGCRYNC 481