BLASTX nr result
ID: Ephedra29_contig00025341
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00025341 (777 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFB33412.1 hypothetical protein 2_5930_01, partial [Pinus mugo] ... 55 2e-06 AEW08296.1 hypothetical protein 2_5930_01, partial [Pinus radiat... 55 2e-06 AEW08295.1 hypothetical protein 2_5930_01, partial [Pinus lamber... 55 2e-06 XP_019078614.1 PREDICTED: uncharacterized protein LOC100257683 [... 57 9e-06 >AFB33412.1 hypothetical protein 2_5930_01, partial [Pinus mugo] AFB33413.1 hypothetical protein 2_5930_01, partial [Pinus mugo] AFB33414.1 hypothetical protein 2_5930_01, partial [Pinus mugo] Length = 113 Score = 55.5 bits (132), Expect = 2e-06 Identities = 33/66 (50%), Positives = 41/66 (62%), Gaps = 10/66 (15%) Frame = +3 Query: 99 DNE-MVDISEL-------FVASDTLDDEEQDF--WLGMDVDALQDPIDDIMGLDVPMDDL 248 DNE +D+S L FV +D L + QD WL + +ALQD D MGLDVPMDDL Sbjct: 47 DNEGAIDLSHLQLPGMEDFVVTDDLGGQGQDLGSWLNFEDEALQDGAGDFMGLDVPMDDL 106 Query: 249 SDLALV 266 SDLA++ Sbjct: 107 SDLAMM 112 >AEW08296.1 hypothetical protein 2_5930_01, partial [Pinus radiata] AFG52179.1 hypothetical protein 2_5930_01, partial [Pinus taeda] AFG52180.1 hypothetical protein 2_5930_01, partial [Pinus taeda] AFG52181.1 hypothetical protein 2_5930_01, partial [Pinus taeda] AFG52182.1 hypothetical protein 2_5930_01, partial [Pinus taeda] AFG52183.1 hypothetical protein 2_5930_01, partial [Pinus taeda] AFG52184.1 hypothetical protein 2_5930_01, partial [Pinus taeda] AFG52185.1 hypothetical protein 2_5930_01, partial [Pinus taeda] AFG52186.1 hypothetical protein 2_5930_01, partial [Pinus taeda] AFG52187.1 hypothetical protein 2_5930_01, partial [Pinus taeda] AFG52188.1 hypothetical protein 2_5930_01, partial [Pinus taeda] AFG52189.1 hypothetical protein 2_5930_01, partial [Pinus taeda] AFG52190.1 hypothetical protein 2_5930_01, partial [Pinus taeda] AFG52191.1 hypothetical protein 2_5930_01, partial [Pinus taeda] AFG52192.1 hypothetical protein 2_5930_01, partial [Pinus taeda] AFG52193.1 hypothetical protein 2_5930_01, partial [Pinus taeda] Length = 113 Score = 55.5 bits (132), Expect = 2e-06 Identities = 33/66 (50%), Positives = 41/66 (62%), Gaps = 10/66 (15%) Frame = +3 Query: 99 DNE-MVDISEL-------FVASDTLDDEEQDF--WLGMDVDALQDPIDDIMGLDVPMDDL 248 DNE +D+S L FV +D L + QD WL + +ALQD D MGLDVPMDDL Sbjct: 47 DNEGAIDLSHLQLPGMEDFVVTDDLGGQGQDLGSWLNFEDEALQDGAGDFMGLDVPMDDL 106 Query: 249 SDLALV 266 SDLA++ Sbjct: 107 SDLAMM 112 >AEW08295.1 hypothetical protein 2_5930_01, partial [Pinus lambertiana] AFB33408.1 hypothetical protein 2_5930_01, partial [Pinus cembra] AFB33409.1 hypothetical protein 2_5930_01, partial [Pinus cembra] AFB33410.1 hypothetical protein 2_5930_01, partial [Pinus cembra] AFB33411.1 hypothetical protein 2_5930_01, partial [Pinus cembra] Length = 113 Score = 55.5 bits (132), Expect = 2e-06 Identities = 41/102 (40%), Positives = 54/102 (52%), Gaps = 17/102 (16%) Frame = +3 Query: 12 KTSVSELEDATVLKKIENQGQEKCDTP-------DRDNE-MVDISEL-------FVASDT 146 K SVS+ + T + QG++K D DNE +D+S L FV +D Sbjct: 15 KLSVSDSGEKTS----DKQGKQKNDHNPGANQDISHDNEGAIDLSHLQLPGMEDFVVNDD 70 Query: 147 LDDEEQDF--WLGMDVDALQDPIDDIMGLDVPMDDLSDLALV 266 L + QD WL + +AL D D MGLDVPMDDLSDLA++ Sbjct: 71 LGGQGQDLGSWLNFEDEALHDGAGDFMGLDVPMDDLSDLAMM 112 >XP_019078614.1 PREDICTED: uncharacterized protein LOC100257683 [Vitis vinifera] CBI27872.3 unnamed protein product, partial [Vitis vinifera] Length = 1304 Score = 57.4 bits (137), Expect = 9e-06 Identities = 37/94 (39%), Positives = 53/94 (56%), Gaps = 9/94 (9%) Frame = +3 Query: 12 KTSVSELEDATVLKKIENQGQEKCDTPDRDNEMVDISELFVAS-------DTLDDEEQDF 170 + SV +L D T + + + D D ++E +D+S L + D LDD+EQD Sbjct: 1213 QASVPKLSDTTRSSIAKEKDEFSMDALD-EHEAIDLSSLQLPGIDVLGVPDDLDDQEQDL 1271 Query: 171 --WLGMDVDALQDPIDDIMGLDVPMDDLSDLALV 266 WL +D D LQD D MGL++PMDDLSDL ++ Sbjct: 1272 GSWLNIDDDGLQD--HDFMGLEIPMDDLSDLNMM 1303