BLASTX nr result
ID: Ephedra29_contig00025211
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00025211 (308 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012850944.1 PREDICTED: snurportin-1 [Erythranthe guttata] EYU... 54 3e-06 XP_010250733.1 PREDICTED: snurportin-1 [Nelumbo nucifera] 54 4e-06 CDP12238.1 unnamed protein product [Coffea canephora] 53 6e-06 >XP_012850944.1 PREDICTED: snurportin-1 [Erythranthe guttata] EYU26080.1 hypothetical protein MIMGU_mgv1a007226mg [Erythranthe guttata] Length = 414 Score = 53.9 bits (128), Expect = 3e-06 Identities = 30/57 (52%), Positives = 35/57 (61%), Gaps = 5/57 (8%) Frame = +1 Query: 151 PSIYHRDSFKTVPVYECNQT*LQTAYNTPLSYAHDELLFCNRFA----ANT-LTLIW 306 PS YHR SFKTV VY C+Q L+ AY P+ Y D LLF N+ A NT L L+W Sbjct: 219 PSPYHRYSFKTVVVYNCDQEGLRAAYTGPVPYLKDGLLFSNKHAHYQSGNTPLVLVW 275 >XP_010250733.1 PREDICTED: snurportin-1 [Nelumbo nucifera] Length = 418 Score = 53.5 bits (127), Expect = 4e-06 Identities = 28/57 (49%), Positives = 34/57 (59%), Gaps = 5/57 (8%) Frame = +1 Query: 151 PSIYHRDSFKTVPVYECNQT*LQTAYNTPLSYAHDELLFCNRFA----ANT-LTLIW 306 PS+YH+ F VP+YECNQ L TAY + Y D LLF N+ A NT L L+W Sbjct: 222 PSLYHKYRFSLVPIYECNQIGLHTAYTGVVPYVKDGLLFYNKHAHYQTGNTPLALVW 278 >CDP12238.1 unnamed protein product [Coffea canephora] Length = 425 Score = 53.1 bits (126), Expect = 6e-06 Identities = 29/57 (50%), Positives = 35/57 (61%), Gaps = 5/57 (8%) Frame = +1 Query: 151 PSIYHRDSFKTVPVYECNQT*LQTAYNTPLSYAHDELLFCNRFA----ANT-LTLIW 306 PS +H+ F TVPVY C+Q LQTAY P+ Y D LLF N+ A NT L L+W Sbjct: 229 PSTFHKYRFATVPVYNCDQEGLQTAYIGPVPYIKDGLLFYNKHAHYETGNTPLALVW 285