BLASTX nr result
ID: Ephedra29_contig00025175
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00025175 (413 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010430213.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 3e-10 XP_006302331.1 hypothetical protein CARUB_v10020389mg [Capsella ... 66 6e-10 XP_010418163.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 6e-10 XP_010473407.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 6e-10 XP_017608106.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 1e-09 XP_002886503.1 pentatricopeptide repeat-containing protein [Arab... 65 2e-09 XP_012484649.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 5e-09 NP_564786.1 pentatricopeptide repeat 336 [Arabidopsis thaliana] ... 63 5e-09 AAM62848.1 putative membrane-associated salt-inducible protein [... 63 7e-09 XP_018846091.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 1e-08 XP_012091376.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 1e-08 XP_006352610.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 2e-08 OAP14485.1 PPR336 [Arabidopsis thaliana] 62 2e-08 XP_010533825.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 2e-08 XP_016723490.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 2e-08 XP_012455712.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 2e-08 CDP04379.1 unnamed protein product [Coffea canephora] 61 2e-08 JAU56535.1 Pentatricopeptide repeat-containing protein, mitochon... 61 3e-08 JAU34408.1 Pentatricopeptide repeat-containing protein, mitochon... 61 3e-08 XP_006391954.1 hypothetical protein EUTSA_v10023498mg [Eutrema s... 60 5e-08 >XP_010430213.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial [Camelina sativa] Length = 411 Score = 66.6 bits (161), Expect = 3e-10 Identities = 33/84 (39%), Positives = 50/84 (59%), Gaps = 3/84 (3%) Frame = -2 Query: 244 TPSTTINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASEL 74 T +T N + Q LC KK ++AK LL L + N TY H+IR FC ++++E+A +L Sbjct: 258 TGVSTYNVRIQSLCKRKKAKEAKALLDGMLSAGMKPNTVTYSHLIRGFCNEDDLEEAKKL 317 Query: 73 LELMINKGIVPSSSTYDLLLIALC 2 ++M+N+G P S Y L+ LC Sbjct: 318 FKVMVNRGCKPDSECYFTLIYYLC 341 >XP_006302331.1 hypothetical protein CARUB_v10020389mg [Capsella rubella] EOA35229.1 hypothetical protein CARUB_v10020389mg [Capsella rubella] Length = 408 Score = 65.9 bits (159), Expect = 6e-10 Identities = 33/84 (39%), Positives = 50/84 (59%), Gaps = 3/84 (3%) Frame = -2 Query: 244 TPSTTINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASEL 74 T +T N + Q LC KK ++AK LL L + N TY H+IR FC ++++E+A +L Sbjct: 255 TGVSTYNIRIQSLCKRKKSKEAKALLDGMLSAGMKPNTVTYSHLIRGFCNEDDLEEAKKL 314 Query: 73 LELMINKGIVPSSSTYDLLLIALC 2 ++M+N+G P S Y L+ LC Sbjct: 315 FKVMVNRGCKPDSECYFTLIYYLC 338 >XP_010418163.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Camelina sativa] Length = 413 Score = 65.9 bits (159), Expect = 6e-10 Identities = 32/81 (39%), Positives = 49/81 (60%), Gaps = 3/81 (3%) Frame = -2 Query: 235 TTINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASELLEL 65 +T N + Q LC KK ++AK LL L + N TY H+IR FC ++++E+A +L ++ Sbjct: 263 STYNIRIQSLCKRKKAKEAKALLDGMLSAGMKPNTVTYSHLIRGFCNEDDLEEAKKLFKV 322 Query: 64 MINKGIVPSSSTYDLLLIALC 2 M+N+G P S Y L+ LC Sbjct: 323 MVNRGCKPDSECYFTLIYYLC 343 >XP_010473407.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Camelina sativa] Length = 414 Score = 65.9 bits (159), Expect = 6e-10 Identities = 32/81 (39%), Positives = 49/81 (60%), Gaps = 3/81 (3%) Frame = -2 Query: 235 TTINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASELLEL 65 +T N + Q LC KK ++AK LL L + N TY H+IR FC ++++E+A +L ++ Sbjct: 264 STYNIRIQSLCKRKKAKEAKALLDGTLSAGMKPNTVTYSHLIRGFCNEDDLEEAKKLFKV 323 Query: 64 MINKGIVPSSSTYDLLLIALC 2 M+N+G P S Y L+ LC Sbjct: 324 MVNRGCKPDSECYFTLIYYLC 344 >XP_017608106.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Gossypium arboreum] XP_017608107.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Gossypium arboreum] Length = 398 Score = 64.7 bits (156), Expect = 1e-09 Identities = 34/81 (41%), Positives = 47/81 (58%), Gaps = 3/81 (3%) Frame = -2 Query: 235 TTINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASELLEL 65 +T N + + LC KK +AK LL L + I N ATY H+I FC + N+E+A L + Sbjct: 248 STYNIRIRSLCMLKKSNEAKALLDGMLSKGIMPNSATYNHLIYGFCREGNLEEAKRLFKS 307 Query: 64 MINKGIVPSSSTYDLLLIALC 2 M+NKG+ P S Y L+ LC Sbjct: 308 MVNKGLKPDSHCYFTLVYFLC 328 >XP_002886503.1 pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] EFH62762.1 pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 408 Score = 64.7 bits (156), Expect = 2e-09 Identities = 32/81 (39%), Positives = 48/81 (59%), Gaps = 3/81 (3%) Frame = -2 Query: 235 TTINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASELLEL 65 +T N + Q LC KK ++AK LL L + N TY H+IR FC +++ E+A +L ++ Sbjct: 258 STYNIRIQSLCKRKKSKEAKALLDGMLSAGMKPNTVTYSHLIRGFCNEDDFEEAKKLFKV 317 Query: 64 MINKGIVPSSSTYDLLLIALC 2 M+N+G P S Y L+ LC Sbjct: 318 MVNRGCKPDSECYFTLIYYLC 338 >XP_012484649.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Gossypium raimondii] XP_012484650.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Gossypium raimondii] XP_016672223.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Gossypium hirsutum] XP_016672224.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Gossypium hirsutum] KJB34610.1 hypothetical protein B456_006G083300 [Gossypium raimondii] KJB34611.1 hypothetical protein B456_006G083300 [Gossypium raimondii] Length = 398 Score = 63.2 bits (152), Expect = 5e-09 Identities = 33/81 (40%), Positives = 46/81 (56%), Gaps = 3/81 (3%) Frame = -2 Query: 235 TTINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASELLEL 65 +T N + + LC KK +AK LL L + I N TY H+I FC + N+E+A L + Sbjct: 248 STYNIRIRSLCMLKKSNEAKALLDGMLSKGIIPNSVTYHHLIYGFCREGNLEEAKRLFKS 307 Query: 64 MINKGIVPSSSTYDLLLIALC 2 M+NKG+ P S Y L+ LC Sbjct: 308 MVNKGLKPDSHCYFTLVYFLC 328 >NP_564786.1 pentatricopeptide repeat 336 [Arabidopsis thaliana] Q8LE47.2 RecName: Full=Pentatricopeptide repeat-containing protein At1g61870, mitochondrial; AltName: Full=Protein PENTATRICOPEPTIDE REPEAT 336; Flags: Precursor AAL16159.1 At1g61870/F8K4_8 [Arabidopsis thaliana] AAC28506.1 Similar to gb|U08285 membrane-associated salt-inducible protein from Nicotiana tabacum. ESTs gb|T44131 and gb|T04378 come from this gene [Arabidopsis thaliana] AAL32936.1 Unknown protein [Arabidopsis thaliana] AAP88326.1 At1g61870 [Arabidopsis thaliana] AEE33898.1 pentatricopeptide repeat 336 [Arabidopsis thaliana] Length = 408 Score = 63.2 bits (152), Expect = 5e-09 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 3/81 (3%) Frame = -2 Query: 235 TTINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASELLEL 65 +T N + Q LC KK ++AK LL L + N TY H+I FC +++ E+A +L ++ Sbjct: 258 STYNIRIQSLCKRKKSKEAKALLDGMLSAGMKPNTVTYSHLIHGFCNEDDFEEAKKLFKI 317 Query: 64 MINKGIVPSSSTYDLLLIALC 2 M+N+G P S Y L+ LC Sbjct: 318 MVNRGCKPDSECYFTLIYYLC 338 >AAM62848.1 putative membrane-associated salt-inducible protein [Arabidopsis thaliana] Length = 407 Score = 62.8 bits (151), Expect = 7e-09 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 3/81 (3%) Frame = -2 Query: 235 TTINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASELLEL 65 +T N + Q LC KK ++AK LL L + N TY H+I FC +++ E+A +L ++ Sbjct: 257 STYNIRIQSLCKKKKSKEAKALLDGMLSAGMKPNTVTYSHLIHGFCNEDDFEEAKKLFKV 316 Query: 64 MINKGIVPSSSTYDLLLIALC 2 M+N+G P S Y L+ LC Sbjct: 317 MVNRGCKPDSECYFTLIYYLC 337 >XP_018846091.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Juglans regia] XP_018810112.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Juglans regia] Length = 403 Score = 62.0 bits (149), Expect = 1e-08 Identities = 31/80 (38%), Positives = 45/80 (56%), Gaps = 3/80 (3%) Frame = -2 Query: 232 TINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASELLELM 62 T N + Q LC KK +AK LL + + N TY H+I FC + N++QA +L + M Sbjct: 254 TYNIRIQSLCKLKKSSEAKALLDGMMSRGMKPNAVTYSHLIHGFCKEGNLDQAKKLFKTM 313 Query: 61 INKGIVPSSSTYDLLLIALC 2 ++KG P S+ Y L+ LC Sbjct: 314 VSKGCKPDSNCYFTLVYFLC 333 >XP_012091376.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial [Jatropha curcas] KDP20770.1 hypothetical protein JCGZ_21241 [Jatropha curcas] Length = 403 Score = 62.0 bits (149), Expect = 1e-08 Identities = 33/81 (40%), Positives = 43/81 (53%), Gaps = 3/81 (3%) Frame = -2 Query: 235 TTINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASELLEL 65 +T N + Q LC K+ +AK LL L I N TY H+I FC + N+E+A L + Sbjct: 253 STYNTRIQSLCKLKRATEAKALLDGMLSRKIEPNSVTYCHLIHGFCSEGNLEEAKRLFKS 312 Query: 64 MINKGIVPSSSTYDLLLIALC 2 M+N G P S Y LL LC Sbjct: 313 MVNHGCQPDSECYFTLLYYLC 333 >XP_006352610.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial [Solanum tuberosum] Length = 402 Score = 61.6 bits (148), Expect = 2e-08 Identities = 32/84 (38%), Positives = 46/84 (54%), Gaps = 3/84 (3%) Frame = -2 Query: 244 TPSTTINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASEL 74 T +T N + Q LC KK +AK LL L + N ATY H+I FC + N+E+A + Sbjct: 249 TGISTYNVRIQSLCKLKKSGEAKALLDGILSRGLKANCATYGHLILGFCKEGNLEEAKSM 308 Query: 73 LELMINKGIVPSSSTYDLLLIALC 2 + M+N G+ P + Y L+ LC Sbjct: 309 FQKMVNSGLKPDAECYFTLVYYLC 332 >OAP14485.1 PPR336 [Arabidopsis thaliana] Length = 408 Score = 61.6 bits (148), Expect = 2e-08 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 3/81 (3%) Frame = -2 Query: 235 TTINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASELLEL 65 +T N + + LC KK ++AK LL L + N TY H+I FC +++ E+A +L ++ Sbjct: 258 STYNIRIRSLCKKKKSKEAKALLDGMLSAGMKPNTVTYSHLIHGFCNEDDFEEAKKLFKI 317 Query: 64 MINKGIVPSSSTYDLLLIALC 2 M+N+G P S Y L+ LC Sbjct: 318 MVNRGCKPDSECYFTLIYYLC 338 >XP_010533825.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial [Tarenaya hassleriana] Length = 410 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/81 (38%), Positives = 45/81 (55%), Gaps = 3/81 (3%) Frame = -2 Query: 235 TTINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASELLEL 65 +T N + Q LC +K +AK LL L I N TY H+I FC ++N+++A L + Sbjct: 260 STYNIRIQSLCKRRKSAEAKALLDGMLSSGIKPNSVTYCHLIHGFCREDNLDEAKRLFKT 319 Query: 64 MINKGIVPSSSTYDLLLIALC 2 M+N+G P S Y L+ LC Sbjct: 320 MVNRGCKPDSECYFTLIYYLC 340 >XP_016723490.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Gossypium hirsutum] Length = 396 Score = 61.2 bits (147), Expect = 2e-08 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 3/80 (3%) Frame = -2 Query: 232 TINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASELLELM 62 T N + Q LC KK +AK LL L + I N TY H+I FC + N+E+A L M Sbjct: 248 TYNIRIQTLCILKKSNEAKTLLHGMLSKGINPNSVTYNHLIHGFCKEGNLEEAKSLFNSM 307 Query: 61 INKGIVPSSSTYDLLLIALC 2 +N+G+ P S+ Y ++ LC Sbjct: 308 VNRGLEPDSNCYFNMVHFLC 327 >XP_012455712.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Gossypium raimondii] KJB69311.1 hypothetical protein B456_011G015700 [Gossypium raimondii] Length = 396 Score = 61.2 bits (147), Expect = 2e-08 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 3/80 (3%) Frame = -2 Query: 232 TINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASELLELM 62 T N + Q LC KK +AK LL L + I N TY H+I FC + N+E+A L M Sbjct: 248 TYNIRIQTLCILKKSNEAKTLLHGMLSKGINPNSVTYNHLIHGFCKEGNLEEAKSLFNSM 307 Query: 61 INKGIVPSSSTYDLLLIALC 2 +N+G+ P S+ Y ++ LC Sbjct: 308 VNRGLEPDSNCYFNMVHFLC 327 >CDP04379.1 unnamed protein product [Coffea canephora] Length = 399 Score = 61.2 bits (147), Expect = 2e-08 Identities = 33/88 (37%), Positives = 47/88 (53%), Gaps = 4/88 (4%) Frame = -2 Query: 253 HQETPSTTI-NPQFQGLCNGKKLQQAKVL---LLRESITTNRATYEHIIRCFCMDNNIEQ 86 H TP T+I N + Q LC K+ ++AK L +L N+ TY H+I FC + ++E+ Sbjct: 242 HSITPGTSIYNIRIQKLCKLKRCREAKALFESILSRGYKPNKVTYHHLIHGFCKEGDLEE 301 Query: 85 ASELLELMINKGIVPSSSTYDLLLIALC 2 A L E M+ GI P Y L+ LC Sbjct: 302 AKGLFERMVKSGIKPEGECYFTLVYFLC 329 >JAU56535.1 Pentatricopeptide repeat-containing protein, mitochondrial [Noccaea caerulescens] Length = 409 Score = 60.8 bits (146), Expect = 3e-08 Identities = 31/81 (38%), Positives = 45/81 (55%), Gaps = 3/81 (3%) Frame = -2 Query: 235 TTINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASELLEL 65 +T N + Q LC KK +AK LL L + N TY H+I FC + E+A +L ++ Sbjct: 259 STHNIRIQSLCKKKKSAEAKALLDGMLSSGMKPNSVTYTHLIHGFCNQGDFEEAKKLFKV 318 Query: 64 MINKGIVPSSSTYDLLLIALC 2 M+N+G P S+ Y L+ LC Sbjct: 319 MVNRGFKPDSACYFTLIYYLC 339 >JAU34408.1 Pentatricopeptide repeat-containing protein, mitochondrial [Noccaea caerulescens] Length = 409 Score = 60.8 bits (146), Expect = 3e-08 Identities = 31/81 (38%), Positives = 45/81 (55%), Gaps = 3/81 (3%) Frame = -2 Query: 235 TTINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASELLEL 65 +T N + Q LC KK +AK LL L + N TY H+I FC + E+A +L ++ Sbjct: 259 STHNIRIQSLCKKKKSAEAKALLDGMLSSGMKPNSVTYTHLIHGFCNQGDFEEAKKLFKV 318 Query: 64 MINKGIVPSSSTYDLLLIALC 2 M+N+G P S+ Y L+ LC Sbjct: 319 MVNRGFKPDSACYFTLIYYLC 339 >XP_006391954.1 hypothetical protein EUTSA_v10023498mg [Eutrema salsugineum] ESQ29240.1 hypothetical protein EUTSA_v10023498mg [Eutrema salsugineum] Length = 408 Score = 60.5 bits (145), Expect = 5e-08 Identities = 30/81 (37%), Positives = 46/81 (56%), Gaps = 3/81 (3%) Frame = -2 Query: 235 TTINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASELLEL 65 +T N + Q LC KK +AK LL L + N TY H+I FC + ++++A +L ++ Sbjct: 258 STHNIRIQSLCKRKKSAEAKALLDGMLSSGMKPNSVTYGHLIHGFCSEGDLDEAKKLFKV 317 Query: 64 MINKGIVPSSSTYDLLLIALC 2 M+N+G P S Y L+ LC Sbjct: 318 MVNRGCKPDSECYFTLIYYLC 338