BLASTX nr result
ID: Ephedra29_contig00025057
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00025057 (355 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012847549.1 PREDICTED: choline transporter-like protein 2 [Er... 55 2e-06 KMZ56970.1 Choline transporter like family [Zostera marina] 54 5e-06 >XP_012847549.1 PREDICTED: choline transporter-like protein 2 [Erythranthe guttata] EYU44898.1 hypothetical protein MIMGU_mgv1a002214mg [Erythranthe guttata] Length = 700 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -1 Query: 115 GAIVGGVASEKIKTKRKCRDIAFLIGFIAFWIGMIVNS 2 G + GGV ++ IK RKCRD+AFL+ FIAFW+ MIVNS Sbjct: 17 GDVNGGVGNDIIKHNRKCRDVAFLVVFIAFWVAMIVNS 54 >KMZ56970.1 Choline transporter like family [Zostera marina] Length = 719 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/42 (57%), Positives = 29/42 (69%) Frame = -1 Query: 127 NGPRGAIVGGVASEKIKTKRKCRDIAFLIGFIAFWIGMIVNS 2 NG G + GG E I+ RKCRD+ FL+ FIAFW+ MIVNS Sbjct: 27 NGECGDVGGGTGGEIIRHNRKCRDLGFLVIFIAFWVAMIVNS 68