BLASTX nr result
ID: Ephedra29_contig00024829
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00024829 (283 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010275039.1 PREDICTED: uncharacterized protein LOC104610224 i... 52 8e-06 XP_010275038.2 PREDICTED: uncharacterized protein LOC104610224 i... 52 8e-06 >XP_010275039.1 PREDICTED: uncharacterized protein LOC104610224 isoform X2 [Nelumbo nucifera] Length = 531 Score = 52.4 bits (124), Expect = 8e-06 Identities = 22/48 (45%), Positives = 33/48 (68%) Frame = +3 Query: 9 DTNMNVNSSSFAFYKEHKKNHKSLLSLHAKSVPSKWDDAERWLVSFSP 152 D + N +SSSF F+K + H ++ ++SVPSKW+DAE+WLV+ P Sbjct: 130 DYDSNASSSSFEFHKGERSLHNPIMRPFSRSVPSKWNDAEKWLVNRQP 177 >XP_010275038.2 PREDICTED: uncharacterized protein LOC104610224 isoform X1 [Nelumbo nucifera] Length = 554 Score = 52.4 bits (124), Expect = 8e-06 Identities = 22/48 (45%), Positives = 33/48 (68%) Frame = +3 Query: 9 DTNMNVNSSSFAFYKEHKKNHKSLLSLHAKSVPSKWDDAERWLVSFSP 152 D + N +SSSF F+K + H ++ ++SVPSKW+DAE+WLV+ P Sbjct: 153 DYDSNASSSSFEFHKGERSLHNPIMRPFSRSVPSKWNDAEKWLVNRQP 200